PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10108524 to PF13355 (DUF4101)

VIMSS10108524 has 801 amino acids

Query:       DUF4101  [M=117]
Accession:   PF13355.6
Description: Protein of unknown function (DUF4101)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      2e-33  101.6   0.0    4.1e-33  100.6   0.0    1.6  1  VIMSS10108524  


Domain annotation for each sequence (and alignments):
>> VIMSS10108524  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  100.6   0.0   4.1e-33   4.1e-33       1     117 []     679     794 ..     679     794 .. 0.99

  Alignments for each domain:
  == domain 1  score: 100.6 bits;  conditional E-value: 4.1e-33
                    HHHHHHHHHHHHHHHHSTT--CCCHHHCB-HHHHHHHHHHHHHHHHCTEEEEEEEEEEEEEEEEEECTSSCEEEEEEEEEEEEEEEESSSCCGEEE CS
        DUF4101   1 AeelvqkWlsaKaealgpehdiekleeiltgpllsqwrkraewlkkngsyweyelqklsvesvevsgkgpdratveatvtEsatlyengqldenqs 96 
                    Ae++v kW+++K+ a+gp+h ie l+e+l+g++l+ w++ra++ ++ g  + y+l klsv+sv+vs++g +ra veat++Esa l +  ++++n++
  VIMSS10108524 679 AENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVDSVTVSADG-TRALVEATLEESACLSDLVHPENNAT 773
                    89*****************************************************************88.9************************* PP

                    EEEEEEEEEEEEEETTCEEEE CS
        DUF4101  97 yestlrvrYelvrengqWkIa 117
                    + +t+++rYe+  ++ +WkI+
  VIMSS10108524 774 DVRTYTTRYEVFWSKSGWKIT 794
                    ********************6 PP



Or compare VIMSS10108524 to CDD or PaperBLAST