PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS12381 to PF13355 (DUF4101)

VIMSS12381 has 714 amino acids

Query:       DUF4101  [M=117]
Accession:   PF13355.6
Description: Protein of unknown function (DUF4101)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.3e-32   96.5   1.1    7.3e-32   96.5   1.1    1.7  2  VIMSS12381  


Domain annotation for each sequence (and alignments):
>> VIMSS12381  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.8   0.1      0.46      0.46      47      80 ..     149     183 ..     132     187 .. 0.57
   2 !   96.5   1.1   7.3e-32   7.3e-32       3     116 ..     591     704 ..     589     705 .. 0.95

  Alignments for each domain:
  == domain 1  score: -2.8 bits;  conditional E-value: 0.46
                 CTEEEEEEEEEE.EEEEEEEECTSSCEEEEEEEEE CS
     DUF4101  47 ngsyweyelqkl.svesvevsgkgpdratveatvt 80 
                 + + ++ye+    s + +   ++++d +++ea+++
  VIMSS12381 149 RWQQQQYEFAATaSLKALARLQQDNDFPALEAEIR 183
                 33334444444447777777666777777777776 PP

  == domain 2  score: 96.5 bits;  conditional E-value: 7.3e-32
                 HHHHHHHHHHHHHHSTT--CCCHHHCB-HHHHHHHHHHHHHHHHCTEEEEEEEEEEEEEEEEEECTSSCEEEEEEEEEEEEEEEESSSCCGEEEE.EEE CS
     DUF4101   3 elvqkWlsaKaealgpehdiekleeiltgpllsqwrkraewlkkngsyweyelqklsvesvevsgkgpdratveatvtEsatlyengqldenqsy.est 100
                  +vq Wl++K+ a+g+++d+  l+++l+ +ll+q r ra+ +++++ y +ye+ kl++   +v++++p+ratv+a+v+E ++ ++ g+++++ s  +++
  VIMSS12381 591 MVVQGWLDSKKLAFGQNYDVGALQSVLAPNLLAQQRGRAQRDQAQKVYHQYEH-KLQILAYQVNPQDPNRATVTARVEEISQPFTLGNQQQKGSAtKDD 688
                 79***************************************************.******************************88888888776599* PP

                 EEEEEEEEEETTCEEE CS
     DUF4101 101 lrvrYelvrengqWkI 116
                 l+vrY+lvr++g+WkI
  VIMSS12381 689 LTVRYQLVRHQGVWKI 704
                 ***************9 PP



Or compare VIMSS12381 to CDD or PaperBLAST