PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS165060 to PF13355 (DUF4101)

VIMSS165060 has 798 amino acids

Query:       DUF4101  [M=117]
Accession:   PF13355.6
Description: Protein of unknown function (DUF4101)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.7e-37  114.1   1.8    5.3e-37  113.1   1.2    1.9  2  VIMSS165060  


Domain annotation for each sequence (and alignments):
>> VIMSS165060  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -4.1   0.0         1         1      77      94 ..     292     309 ..     282     318 .. 0.68
   2 !  113.1   1.2   5.3e-37   5.3e-37       1     117 []     678     791 ..     678     791 .. 0.98

  Alignments for each domain:
  == domain 1  score: -4.1 bits;  conditional E-value: 1
                  EEEEEEEEEEESSSCCGE CS
      DUF4101  77 atvtEsatlyengqlden 94 
                   tv E+ +l++ + ++++
  VIMSS165060 292 LTVAEQHKLFDGESKRPS 309
                  689999999976655543 PP

  == domain 2  score: 113.1 bits;  conditional E-value: 5.3e-37
                  HHHHHHHHHHHHHHHHSTT--CCCHHHCB-HHHHHHHHHHHHHHHHCTEEEEEEEEEEEEEEEEEECTSSCEEEEEEEEEEEEEEEESSSCCGEEEEE CS
      DUF4101   1 AeelvqkWlsaKaealgpehdiekleeiltgpllsqwrkraewlkkngsyweyelqklsvesvevsgkgpdratveatvtEsatlyengqldenqsye 98 
                  A++++++Wl +Ka+alg eh+ie+l+eiltg++lsqwr  a ++k+++ ++ey + +++v+s+++s+ +p+ra+v atv+E +++yengq+   +s++
  VIMSS165060 678 ARKIIENWLATKASALGAEHKIESLNEILTGSALSQWRLIALQDKADNRHREYSH-SVKVDSISKSDIDPNRASVGATVRELTQFYENGQKG--KSSD 772
                  789****************************************************.*********************************888..788* PP

                  EEEEEEEEEEEETTCEEEE CS
      DUF4101  99 stlrvrYelvrengqWkIa 117
                  ++lrvrYel+r+++ W+I+
  VIMSS165060 773 ERLRVRYELIRQDDIWRIQ 791
                  ******************7 PP



Or compare VIMSS165060 to CDD or PaperBLAST