PaperBLAST – Find papers about a protein or its homologs

 

Align biolip::5gtbA to PF13355 (ARC6-like_IMS)

biolip::5gtbA has 130 amino acids

Query:       ARC6-like_IMS  [M=117]
Accession:   PF13355.10
Description: ARC6-like, IMS domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      2e-36  111.3   0.0    2.3e-36  111.2   0.0    1.0  1  biolip::5gtbA  


Domain annotation for each sequence (and alignments):
>> biolip::5gtbA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  111.2   0.0   2.3e-36   2.3e-36       1     117 []       8     123 ..       8     123 .. 0.99

  Alignments for each domain:
  == domain 1  score: 111.2 bits;  conditional E-value: 2.3e-36
  ARC6-like_IMS   1 AeeliqkWlsaKaealgpehdiesleeiltgpllsqwrkraaqlkkngsyweyklkslsvesvevsskgpdratveatveEsaqlyengqlkenrs 96 
                    Ae+++ kW+++K+ a+gp+h+ie l+e+l+g +l+ w++raa++++ g  ++y+l +lsv+sv+vs++g +ra veat+eEsa l +  ++++n++
  biolip::5gtbA   8 AENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVDSVTVSADG-TRALVEATLEESACLSDLVHPENNAT 102
                    89****************************************************************988.9************************* PP

  ARC6-like_IMS  97 ydstlrvrYelvrengkWkIq 117
                    + +t+++rYe+ +++++WkI+
  biolip::5gtbA 103 DVRTYTTRYEVFWSKSGWKIT 123
                    *******************96 PP



Or compare biolip::5gtbA to CDD or PaperBLAST