PaperBLAST – Find papers about a protein or its homologs

 

Align NP_249812.1 to PF13689 (DUF4154)

NP_249812.1 has 190 amino acids

Query:       DUF4154  [M=143]
Accession:   PF13689.6
Description: YfiR/HmsC-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.9e-36  111.0   0.0    3.4e-36  110.8   0.0    1.1  1  NP_249812.1  


Domain annotation for each sequence (and alignments):
>> NP_249812.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  110.8   0.0   3.4e-36   3.4e-36       4     143 .]      48     185 ..      45     185 .. 0.92

  Alignments for each domain:
  == domain 1  score: 110.8 bits;  conditional E-value: 3.4e-36
                  HHHHHHHHHTTEE-SS--SS..EEEEEES-BSSTHHHHT-EE-TTS..-EEEEEEE-TT-TT..HH-SEEEE-S--HHHHHHHHHHHTTS--EEEESS CS
      DUF4154   4 kaaflynfakyteWpeeagssplrlcvlgddpfaaaleallegkkvrgrpievrrlddssea..eechvlyigesearelaailkalagkpvLtvsdg 99 
                    ++l+++++y++Wp+e     l+lcv+g++++a+ l + +   +++gr+++++r +  ++     c+v+y+g  ++re+++++++lag+pvL++s++
  NP_249812.1  48 VSQVLLGIFSYVRWPKEPAV--LQLCVVGPTEYADGLLRGMV--QANGRRVHAERRAVDNPDlgTLCNVIYLGVVDERERQQVFRSLAGHPVLSISER 141
                  56899*************99..9****************655..6677888888888877444577******************************** PP

                  TSGGSSS-SEEEEESSSSEEEEEEHHHHHHSSSEE-GGGGHHHH CS
      DUF4154 100 egfaeqggminLvredgrlrfeiNldaarraglkisskLLrLAr 143
                   + ++ g+m++L++ + r++fe Nld+++r+g+++++++L+LAr
  NP_249812.1 142 GTECSVGSMFCLNVGGPRITFEANLDSIARSGVRVHPSVLKLAR 185
                  *******************************************8 PP



Or compare NP_249812.1 to CDD or PaperBLAST