PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P64548 to PF13689 (DUF4154)

SwissProt::P64548 has 172 amino acids

Query:       DUF4154  [M=143]
Accession:   PF13689.6
Description: YfiR/HmsC-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.1e-33  102.7   0.0    1.2e-33  102.5   0.0    1.1  1  SwissProt::P64548  


Domain annotation for each sequence (and alignments):
>> SwissProt::P64548  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.5   0.0   1.2e-33   1.2e-33       6     143 .]      34     167 ..      29     167 .. 0.90

  Alignments for each domain:
  == domain 1  score: 102.5 bits;  conditional E-value: 1.2e-33
                        HHHHHHHTTEE-SS--SS..EEEEEES-BSSTHHHHT-EE-TTS..-EEEEEEE-TT-TT..HH-SEEEE-S--HHHHHHHHHHHTTS--EE CS
            DUF4154   6 aflynfakyteWpeeagssplrlcvlgddpfaaaleallegkkvrgrpievrrlddssea..eechvlyigesearelaailkalagkpvLt 95 
                         ++ ++++yt+Wp+ +g+   +lc++++++f  al+++++ +++   p+  + +++++ea  ++c+ +y+g+++++ + ++++++++k++L+
  SwissProt::P64548  34 MMVSGIVSYTRWPALSGP--PKLCIFSSSRFSTALQENAA-TSL---PYLPVIIHTQQEAmiSGCNGFYFGNESPTFQMELTEQYPSKALLL 119
                        6899*************9..8****************555.445...55555555555444699**************************** PP

                        EESSTSGGSSS-SEEEEESSSSEEEEEEHHHHHHSSSEE-GGGGHHHH CS
            DUF4154  96 vsdgegfaeqggminLvredgrlrfeiNldaarraglkisskLLrLAr 143
                        ++++++ +  g++++L+++++ +rf +Nlda++r+g+k+++++L+LAr
  SwissProt::P64548 120 IAEQNTECIIGSAFCLIIHNNDVRFAVNLDALSRSGVKVNPDVLMLAR 167
                        ***********************************************8 PP



Or compare SwissProt::P64548 to CDD or PaperBLAST