PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2198562 to PF13689 (DUF4154)

VIMSS2198562 has 190 amino acids

Query:       DUF4154  [M=143]
Accession:   PF13689.6
Description: YfiR/HmsC-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.6e-36  110.1   0.0    6.6e-36  109.9   0.0    1.1  1  VIMSS2198562  


Domain annotation for each sequence (and alignments):
>> VIMSS2198562  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.9   0.0   6.6e-36   6.6e-36       4     143 .]      48     185 ..      45     185 .. 0.92

  Alignments for each domain:
  == domain 1  score: 109.9 bits;  conditional E-value: 6.6e-36
                   HHHHHHHHHTTEE-SS--SS..EEEEEES-BSSTHHHHT-EE-TTS..-EEEEEEE-TT-TT..HH-SEEEE-S--HHHHHHHHHHHTTS--EEEES CS
       DUF4154   4 kaaflynfakyteWpeeagssplrlcvlgddpfaaaleallegkkvrgrpievrrlddssea..eechvlyigesearelaailkalagkpvLtvsd 98 
                     ++l+++++y++Wp+e     l+lcv+g++++a+ l + +   +++gr+++++r +  ++     c+v+y+g  ++re+++++ +lag+pvL++s+
  VIMSS2198562  48 VSQVLLGIFSYVRWPKEPAV--LQLCVVGPTEYADGLLRGMV--QANGRRVHAERRAVDNPDlgTLCNVIYLGVVDERERQQVFHSLAGHPVLSISE 140
                   56899*************99..9****************655..6677888888888877444577******************************* PP

                   STSGGSSS-SEEEEESSSSEEEEEEHHHHHHSSSEE-GGGGHHHH CS
       DUF4154  99 gegfaeqggminLvredgrlrfeiNldaarraglkisskLLrLAr 143
                   + + ++ g+m++L++ + r++fe Nld+++r+g+++++++L+LAr
  VIMSS2198562 141 RGTECSVGSMFCLNVGGPRITFEANLDSIARSGVRVHPSVLKLAR 185
                   ********************************************8 PP



Or compare VIMSS2198562 to CDD or PaperBLAST