PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS274248 to PF13689 (DUF4154)

VIMSS274248 has 207 amino acids

Query:       DUF4154  [M=143]
Accession:   PF13689.6
Description: YfiR/HmsC-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.2e-36  110.5   0.0    5.1e-36  110.3   0.0    1.1  1  VIMSS274248  


Domain annotation for each sequence (and alignments):
>> VIMSS274248  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  110.3   0.0   5.1e-36   5.1e-36       3     143 .]      63     201 ..      61     201 .. 0.96

  Alignments for each domain:
  == domain 1  score: 110.3 bits;  conditional E-value: 5.1e-36
                  HHHHHHHHHHTTEE-SS--SS..EEEEEES-BSSTHHHHT-EE-TTS..-EEEEEEE-TT-TT..HH-SEEEE-S--HHHHHHHHHHHTTS--EEEES CS
      DUF4154   3 lkaaflynfakyteWpeeagssplrlcvlgddpfaaaleallegkkvrgrpievrrlddssea..eechvlyigesearelaailkalagkpvLtvsd 98 
                    a++++++++y +Wp +     +rlcv++++++a+ l + +  +++  +p++ +r++ +++   ++c+v+y+g+ e ++++++  +l+g+p+Lt+s+
  VIMSS274248  63 AAARMVLGIISYSRWPVAPPV--IRLCVISPTDYAEMLFNPALMETT--HPVQTQRYSLPNNSlnSKCDVVYLGHIELQQRQQLSIQLNGTPILTISE 156
                  5799**************999..*****************8888887..9**********9887888******************************* PP

                  STSGGSSS-SEEEEESSSSEEEEEEHHHHHHSSSEE-GGGGHHHH CS
      DUF4154  99 gegfaeqggminLvredgrlrfeiNldaarraglkisskLLrLAr 143
                  + + +  g++++L ++d++++f++N+da++r g++i++++L+LAr
  VIMSS274248 157 DYNECTFGSVFCLLLNDKQVSFKVNMDALARGGVRIHPSVLQLAR 201
                  ********************************************8 PP



Or compare VIMSS274248 to CDD or PaperBLAST