PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5797367 to PF13689 (DUF4154)

VIMSS5797367 has 172 amino acids

Query:       DUF4154  [M=143]
Accession:   PF13689.6
Description: YfiR/HmsC-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    8.5e-33   99.8   0.0    9.8e-33   99.6   0.0    1.0  1  VIMSS5797367  


Domain annotation for each sequence (and alignments):
>> VIMSS5797367  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.6   0.0   9.8e-33   9.8e-33       4     143 .]      32     167 ..      29     167 .. 0.94

  Alignments for each domain:
  == domain 1  score: 99.6 bits;  conditional E-value: 9.8e-33
                   HHHHHHHHHTTEE-SS--SS..EEEEEES-BSSTHHHHT-EE-TTS..-EEEEEEE-TT-TTHH-SEEEE-S--HHHHHHHHHHHTTS--EEEESST CS
       DUF4154   4 kaaflynfakyteWpeeagssplrlcvlgddpfaaaleallegkkvrgrpievrrlddsseaeechvlyigesearelaailkalagkpvLtvsdge 100
                     a++ ++++yt+Wp+ +g+   rlc++++++f ++l+++++ +    +p+++r+++++ +a +c+ +y+g+++++ + ++++ ++ +++L++++++
  VIMSS5797367  32 VRAIVSGIVSYTHWPALSGP--PRLCIFSSARFVRVLSEEADWA-FPYQPLVIRTTQEALSA-RCDGFYFGNESPAYQVELTRHYPVNALLLIAEQN 124
                   579****************9..8****************77765.77899999998888877.5********************************* PP

                   SGGSSS-SEEEEESSSSEEEEEEHHHHHHSSSEE-GGGGHHHH CS
       DUF4154 101 gfaeqggminLvredgrlrfeiNldaarraglkisskLLrLAr 143
                   + +  g++++L+++++ ++f++Nld+++++g+++++++L+LAr
  VIMSS5797367 125 TECIIGSAFCLIINNDEVKFSVNLDSLSHSGVRVNPEVLMLAR 167
                   ******************************************8 PP



Or compare VIMSS5797367 to CDD or PaperBLAST