PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001007199.1 to PF13778 (DUF4174)

NP_001007199.1 has 867 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.4e-111  353.9   0.3    2.5e-42  130.4   0.9    3.7  3  NP_001007199.1  


Domain annotation for each sequence (and alignments):
>> NP_001007199.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.1   0.0   3.5e-34   3.5e-34       2     120 .]     126     254 ..     125     254 .. 0.97
   2 !  130.4   0.9   2.5e-42   2.5e-42       1     120 []     541     675 ..     541     675 .. 0.99
   3 !  114.6   0.0     2e-37     2e-37       1     120 []     698     830 ..     698     830 .. 0.97

  Alignments for each domain:
  == domain 1  score: 104.1 bits;  conditional E-value: 3.5e-34
         DUF4174   2 LasfkwkrRlLlisapseedekykqqreele.eqecelaeRklvvltivgsgaketgki.........eeeqlsaeliselrkelklsekdfsmv 86 
                     Lasf++k+RlL+isap+++d +y+ +++ l+ e  celaeR++  +++++++++  gki          ee+l+ +li +l+  lkl++ +f mv
  NP_001007199.1 126 LASFAGKNRLLVISAPHDSDGYYRLMMSLLKpEVYCELAERHVHQIVMFHQEGELGGKIrritnegkvMEEPLDTALIPRLMTFLKLEKGKFGMV 220
                     89****************************66***************************99999999988899********************** PP

         DUF4174  87 LigkdggvkeryekpisleelfdlIDsmpmRqqE 120
                     L++k ++v+ery++p++le+++++ID+ pmR+ E
  NP_001007199.1 221 LLKKTLQVEERYPYPVRLEAMYEVIDQSPMRKME 254
                     *******************************987 PP

  == domain 2  score: 130.4 bits;  conditional E-value: 2.5e-42
         DUF4174   1 fLasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeql...............saeliselrkelklse 80 
                     fL+ f+ +rRl+li++p+ee+++y qqr+e+ e+ ce+a Rk++++ti+g+ +++t+ki+++ql               +++li+elrke+++++
  NP_001007199.1 541 FLDYFESRRRLILITSPTEENSMYIQQRDEYLEHVCEMAIRKVTIITIFGTFRNSTMKIDHYQLekdkpmkglrqedleNQDLIMELRKEYGMTY 635
                     699******************************************************************************************** PP

         DUF4174  81 kdfsmvLigkdggvkeryekpisleelfdlIDsmpmRqqE 120
                     +df +vL+++d++ k+ ye pi+++++fd+ID++++R +E
  NP_001007199.1 636 NDFYVVLTDLDMKAKQYYEVPIAMKAVFDYIDTFSSRIRE 675
                     *************************************998 PP

  == domain 3  score: 114.6 bits;  conditional E-value: 2e-37
         DUF4174   1 fLasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgki............eeeqlsaeliselrkelklsekdf 83 
                     fL++f+w+rRl +isap++e++ y+qq+ +l++q+c+l  R+++vl++vg++   +g +            e+e +sa+l++++r+++++s+++f
  NP_001007199.1 698 FLSRFRWRRRLFVISAPNDEEWAYQQQLYALTSQACNLGLRHVSVLKLVGTDLLDMGGVlelypingsatvEREGISATLVRDIRNYFQISPEYF 792
                     699*************************************************999998899999999999888899******************* PP

         DUF4174  84 smvLigkdggvkeryekpi.sleelfdlIDsmpmRqqE 120
                     sm+L+gkdg+vk +y++p+ s++ ++dlIDsm++R+qE
  NP_001007199.1 793 SMLLVGKDGNVKSWYPSPMwSMAIIYDLIDSMQLRRQE 830
                     *************************************9 PP



Or compare NP_001007199.1 to CDD or PaperBLAST