PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001164221.1 to PF13778 (DUF4174)

NP_001164221.1 has 444 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-34  105.0   0.0    2.6e-34  104.5   0.0    1.2  1  NP_001164221.1  


Domain annotation for each sequence (and alignments):
>> NP_001164221.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.5   0.0   2.6e-34   2.6e-34       2     120 .]     313     431 ..     312     431 .. 0.99

  Alignments for each domain:
  == domain 1  score: 104.5 bits;  conditional E-value: 2.6e-34
         DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeqlsaeliselrkelklsekdfsmvLigkdggvke 96 
                     L++f++krRlL++s+p++ +  y+ q+ +l++++c+l+ R+++v+++vg  ++  g+i  + ++++l+ +lr  l+++  +fsmvL++k+g +ke
  NP_001164221.1 313 LDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKE 407
                     89***************************************************************************9999************** PP

         DUF4174  97 ryekpisleelfdlIDsmpmRqqE 120
                     ry + + + +lf+lID++p+R++E
  NP_001164221.1 408 RYVSLVMPVALFNLIDTFPLRKEE 431
                     **********************98 PP



Or compare NP_001164221.1 to CDD or PaperBLAST