PaperBLAST – Find papers about a protein or its homologs

 

Align NP_055282.1 to PF13778 (DUF4174)

NP_055282.1 has 465 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-39  121.5   0.3      2e-39  121.1   0.3    1.2  1  NP_055282.1  


Domain annotation for each sequence (and alignments):
>> NP_055282.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.1   0.3     2e-39     2e-39       2     120 .]     335     453 ..     334     453 .. 0.99

  Alignments for each domain:
  == domain 1  score: 121.1 bits;  conditional E-value: 2e-39
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeqlsaeliselrkelklsekdfsmvLigkdggvkerye 99 
                  L++f++k+RlL+isap+ ++++yk+q ++l++++c+l+ R+++++++vg+ ++e+g+i+e+qlsa+ i+elr+  +l++++f+mvLi+k+g ++ ry 
  NP_055282.1 335 LDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYM 432
                  89************************************************************************************************ PP

      DUF4174 100 kpisleelfdlIDsmpmRqqE 120
                  +p+++ee+f +ID + + +qE
  NP_055282.1 433 EPVTPEEIFTFIDDYLLSNQE 453
                  **************9999988 PP



Or compare NP_055282.1 to CDD or PaperBLAST