PaperBLAST – Find papers about a protein or its homologs

 

Align NP_058607.1 to PF13778 (DUF4174)

NP_058607.1 has 464 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.5e-35  107.0   0.0    5.9e-35  106.6   0.0    1.2  1  NP_058607.1  


Domain annotation for each sequence (and alignments):
>> NP_058607.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.6   0.0   5.9e-35   5.9e-35       2     120 .]     333     451 ..     332     451 .. 0.99

  Alignments for each domain:
  == domain 1  score: 106.6 bits;  conditional E-value: 5.9e-35
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeqlsaeliselrkelklsekdfsmvLigkdggvkerye 99 
                  L++f++krRlL++s+p++ +  y+ q+ +l++++c+l+ R+++v+++vg  ++  g+i+ + ++++l+ +lr  l+++  +fsmv+++k+g +kery 
  NP_058607.1 333 LDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHVTVVELVGVFPTLIGRIRAKIMPPALALQLRLLLRIPLYSFSMVVVDKHGMDKERYV 430
                  89***************************************************************************9999***************** PP

      DUF4174 100 kpisleelfdlIDsmpmRqqE 120
                  + +++ +lf+lID++p+R++E
  NP_058607.1 431 SLVTPMALFNLIDTFPLRKEE 451
                  *******************98 PP



Or compare NP_058607.1 to CDD or PaperBLAST