PaperBLAST – Find papers about a protein or its homologs

 

Align NP_071988.2 to PF13778 (DUF4174)

NP_071988.2 has 949 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     2e-109  347.0   0.0    1.8e-40  124.5   0.3    3.5  3  NP_071988.2  


Domain annotation for each sequence (and alignments):
>> NP_071988.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  100.1   0.0     6e-33     6e-33       2     120 .]     142     270 ..     141     270 .. 0.96
   2 !  124.5   0.3   1.8e-40   1.8e-40       2     119 ..     615     747 ..     614     748 .. 0.98
   3 !  118.2   0.0   1.5e-38   1.5e-38       1     120 []     770     901 ..     770     901 .. 0.96

  Alignments for each domain:
  == domain 1  score: 100.1 bits;  conditional E-value: 6e-33
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreel.eeqecelaeRklvvltivgsgaketgki.........eeeqlsaeliselrkelklsekdfsmvLig 89 
                  Lasf++k+R+++isap++++ +y+ +++ l ++  celaeR++  +++++++++e gk+          e++l+++li +l++ lkl++ +fsmvL++
  NP_071988.2 142 LASFAGKNRVWVISAPHASEGYYRLMMSLLkDDVYCELAERHIQQIVLFHQAGEEGGKVrritsegqiLEQPLDPNLIPKLMSFLKLEKGKFSMVLLK 239
                  89****************************559**************************99999998888899************************* PP

      DUF4174  90 kdggvkeryekpisleelfdlIDsmpmRqqE 120
                  k ++v+ery++p++le+++++ID+ p+R+ E
  NP_071988.2 240 KTLQVEERYPYPVRLEAMYEVIDQGPIRRIE 270
                  ****************************976 PP

  == domain 2  score: 124.5 bits;  conditional E-value: 1.8e-40
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeql...............saeliselrkelklsekdfs 84 
                  L sf++krRlLli++p++e+++y qqr+e+ e+ c++a R+++v+ti+g  +++++ki++ ql               +++liselrke++++++df 
  NP_071988.2 615 LGSFEGKRRLLLITTPKAENNMYVQQRDEYLESFCKMATRRISVVTIFGPVNNSSMKIDHFQLdnekpmrvvddedlvDQHLISELRKEYGMTYNDFF 712
                  679*******************************************************99999999999***************************** PP

      DUF4174  85 mvLigkdggvkeryekpisleelfdlIDsmpmRqq 119
                  mvL++ d++vk+ ye pi+++++fdlID++++R +
  NP_071988.2 713 MVLTDVDLRVKQYYEVPIAMKSVFDLIDTFQSRIK 747
                  *********************************86 PP

  == domain 3  score: 118.2 bits;  conditional E-value: 1.5e-38
      DUF4174   1 fLasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgki............eeeqlsaeliselrkelklsekdfsmv 86 
                  fL++f+w+rRlL+isap++ed+ y+qq+++l++q+c++  R++++l+++g g++  g i            e+e+++a+l++++r+++++s+++fsm+
  NP_071988.2 770 FLSRFRWRRRLLVISAPNDEDWAYSQQLSALNGQACNFGLRHITILKLLGVGEEVGG-IlelfpingsstvEREDVPAHLVKDIRNYFQVSPEYFSML 866
                  699**********************************************99987766.559999999999999999********************** PP

      DUF4174  87 Ligkdggvkeryekpi.sleelfdlIDsmpmRqqE 120
                  L+gkdg+vk +y++p+ s+  ++dlIDsm++R+qE
  NP_071988.2 867 LVGKDGNVKSWYPSPMwSMVIVYDLIDSMQLRRQE 901
                  **********************************9 PP



Or compare NP_071988.2 to CDD or PaperBLAST