PaperBLAST – Find papers about a protein or its homologs

 

Align NP_955806.1 to PF13778 (DUF4174)

NP_955806.1 has 950 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   6.5e-110  348.5   0.0    1.2e-41  128.2   0.4    3.6  3  NP_955806.1  


Domain annotation for each sequence (and alignments):
>> NP_955806.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.4   0.0     2e-32     2e-32       2     120 .]     142     270 ..     141     270 .. 0.96
   2 !  128.2   0.4   1.2e-41   1.2e-41       2     119 ..     616     748 ..     615     749 .. 0.98
   3 !  117.5   0.0   2.6e-38   2.6e-38       1     120 []     771     902 ..     771     902 .. 0.96

  Alignments for each domain:
  == domain 1  score: 98.4 bits;  conditional E-value: 2e-32
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreel.eeqecelaeRklvvltivgsgaketgki.........eeeqlsaeliselrkelklsekdfsmvLig 89 
                  Lasf++k+R+++isap++++ +y+ +++ l ++  celaeR++  +++++++++e gk+          e++l+++li +l++ lkl++ +f mvL++
  NP_955806.1 142 LASFAGKNRVWVISAPHASEGYYRLMMSLLkDDVYCELAERHIQQIVLFHQAGEEGGKVrritsegqiLEQPLDPSLIPKLMSFLKLEKGKFGMVLLK 239
                  89****************************559**************************99999998888899************************* PP

      DUF4174  90 kdggvkeryekpisleelfdlIDsmpmRqqE 120
                  k ++v+ery++p++le+++++ID+ p+R+ E
  NP_955806.1 240 KTLQVEERYPYPVRLEAMYEVIDQGPIRRIE 270
                  ****************************976 PP

  == domain 2  score: 128.2 bits;  conditional E-value: 1.2e-41
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeql...............saeliselrkelklsekdfs 84 
                  L sf++krRlLli+ap++e+++y qqr+e+ e+ c++a Rk++v+ti+g  +++t+ki++ ql               ++ liselrke++++++df 
  NP_955806.1 616 LGSFEGKRRLLLITAPKAENNMYVQQRDEYLESFCKMATRKISVITIFGPVNNSTMKIDHFQLdnekpmrvvddedlvDQRLISELRKEYGMTYNDFF 713
                  679*******************************************************99999999999***************************** PP

      DUF4174  85 mvLigkdggvkeryekpisleelfdlIDsmpmRqq 119
                  mvL++ d++vk+ ye pi+++++fdlID++++R +
  NP_955806.1 714 MVLTDVDLRVKQYYEVPITMKSVFDLIDTFQSRIK 748
                  *********************************86 PP

  == domain 3  score: 117.5 bits;  conditional E-value: 2.6e-38
      DUF4174   1 fLasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgki...........eeeqlsaeliselrkelklsekdfsmvL 87 
                  fL++f+w+rRlL+isap++ed+ y+qq+++l++q+c++  R++++l+++g g++  g +           e+e+++a+l++++r+++++s+++fsm+L
  NP_955806.1 771 FLSRFRWRRRLLVISAPNDEDWAYSQQLSALSGQACNFGLRHITILKLLGVGEEVGGVLelfpingssvvEREDVPAHLVKDIRNYFQVSPEYFSMLL 868
                  699***********************************************9998877669999999999988999*********************** PP

      DUF4174  88 igkdggvkeryekpi.sleelfdlIDsmpmRqqE 120
                  +gkdg+vk +y++p+ s+  ++dlIDsm++R+qE
  NP_955806.1 869 VGKDGNVKSWYPSPMwSMVIVYDLIDSMQLRRQE 902
                  *********************************9 PP



Or compare NP_955806.1 to CDD or PaperBLAST