PaperBLAST – Find papers about a protein or its homologs

 

Align NP_989762.1 to PF13778 (DUF4174)

NP_989762.1 has 958 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   3.1e-110  349.5   0.1    5.4e-42  129.3   1.4    3.5  3  NP_989762.1  


Domain annotation for each sequence (and alignments):
>> NP_989762.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.8   0.0   1.6e-32   1.6e-32       2     120 .]     142     270 ..     141     270 .. 0.96
   2 !  129.3   1.4   5.4e-42   5.4e-42       2     119 ..     624     756 ..     623     757 .. 0.98
   3 !  116.2   0.0   6.5e-38   6.5e-38       1     120 []     779     910 ..     779     910 .. 0.94

  Alignments for each domain:
  == domain 1  score: 98.8 bits;  conditional E-value: 1.6e-32
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreel.eeqecelaeRklvvltivgsgaketgki.........eeeqlsaeliselrkelklsekdfsmvLig 89 
                  Lasf++k+R+++isap++++ +y+ +++ l ++  celaeR++  +++++++++e gk+          e++l+++li +l++ lkl++ +f mvL++
  NP_989762.1 142 LASFAGKNRVWVISAPHASEGYYRLMMSLLkNDVYCELAERHIQQIVLFHEEGEEGGKVrritnegkiLEQPLDPALIPKLMSFLKLEKGKFGMVLLK 239
                  89****************************669**************************99999888888889************************* PP

      DUF4174  90 kdggvkeryekpisleelfdlIDsmpmRqqE 120
                  k ++v+ery++p++le+++++ID+ p+R+ E
  NP_989762.1 240 KTLQVEERYPYPVRLEAMYEVIDQNPIRKIE 270
                  ****************************976 PP

  == domain 2  score: 129.3 bits;  conditional E-value: 5.4e-42
      DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeql...............saeliselrkelklsekdfs 84 
                  L+ f++krRl+li++p++++++y qqr+e+ e+ c++a Rk++v+ti+g+ +++++ki++ ql               +++liselrke++++++df 
  NP_989762.1 624 LDYFEGKRRLILITTPKADNTMYVQQRDEYLESFCKMATRKISVITIFGTMNNSSMKIDHFQLdnekpmkviededlvDQQLISELRKEYGMTYNDFF 721
                  899*******************************************************99999999999***************************** PP

      DUF4174  85 mvLigkdggvkeryekpisleelfdlIDsmpmRqq 119
                  mvL++ d++vk+ ye pi+++++fdlID++++R +
  NP_989762.1 722 MVLTDTDMKVKQYYEVPIAMKSVFDLIDTFQSRIK 756
                  *********************************86 PP

  == domain 3  score: 116.2 bits;  conditional E-value: 6.5e-38
      DUF4174   1 fLasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgki...........eeeqlsaeliselrkelklsekdfsmvL 87 
                  fL++f+w+rRl++isaps+ed+ y+qq+ +l++q+c++  R++++l+++g g+   g +           ++e+++a+l++++r+++++s+++fsm+L
  NP_989762.1 779 FLSRFRWRRRLVVISAPSDEDWAYSQQLAALSGQACNFGLRHITILKLLGVGEDIGGVLelypingsatvDREDIPANLVKDIRNYFQISPEYFSMLL 876
                  699*********************************************999977666558888888888888888*********************** PP

      DUF4174  88 igkdggvkeryekpi.sleelfdlIDsmpmRqqE 120
                  +gkdg+vk +y++p+ s++ ++dlIDsm++R+qE
  NP_989762.1 877 VGKDGNVKSWYPSPMwSMAIVYDLIDSMQLRRQE 910
                  *********************************9 PP



Or compare NP_989762.1 to CDD or PaperBLAST