PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::B5DF94 to PF13778 (DUF4174)

SwissProt::B5DF94 has 466 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.9e-39  121.1   0.2    2.5e-39  120.7   0.2    1.2  1  SwissProt::B5DF94  


Domain annotation for each sequence (and alignments):
>> SwissProt::B5DF94  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  120.7   0.2   2.5e-39   2.5e-39       2     120 .]     336     454 ..     335     454 .. 0.99

  Alignments for each domain:
  == domain 1  score: 120.7 bits;  conditional E-value: 2.5e-39
            DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeqlsaeliselrkelklsekdfsmvLigkdgg 93 
                        L++f++k+RlL++sap+ ++++yk+q ++l++++c+l+ R+++++++vg+ ++e+g+i+e+qlsa  i+elr+  +l++++f+mvLi+k+g 
  SwissProt::B5DF94 336 LDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGI 427
                        89****************************************************************************************** PP

            DUF4174  94 vkeryekpisleelfdlIDsmpmRqqE 120
                        ++ery +p+++ee+f +ID + + +qE
  SwissProt::B5DF94 428 DRERYMEPVTPEEIFTFIDDYLLSNQE 454
                        ********************9999988 PP



Or compare SwissProt::B5DF94 to CDD or PaperBLAST