PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8R054 to PF13778 (DUF4174)

SwissProt::Q8R054 has 468 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.3e-39  120.3   0.1    4.5e-39  119.9   0.1    1.2  1  SwissProt::Q8R054  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8R054  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  119.9   0.1   4.5e-39   4.5e-39       2     120 .]     338     456 ..     337     456 .. 0.98

  Alignments for each domain:
  == domain 1  score: 119.9 bits;  conditional E-value: 4.5e-39
            DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeqlsaeliselrkelklsekdfsmvLigkdgg 93 
                        L++f++k+RlL++sap+ ++++yk+q ++l++++c+l+ R+++++++vg+ ++e+g+i+e+qlsa  i+elr+  +l++++f+mvLi+k+g 
  SwissProt::Q8R054 338 LDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGI 429
                        89****************************************************************************************** PP

            DUF4174  94 vkeryekpisleelfdlIDsmpmRqqE 120
                        ++ery +p+++ee+f +ID + + ++E
  SwissProt::Q8R054 430 DRERYMEPVTPEEIFTFIDDYLLSNEE 456
                        ********************9988776 PP



Or compare SwissProt::Q8R054 to CDD or PaperBLAST