PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006522563.1 to PF13778 (DUF4174)

XP_006522563.1 has 949 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   3.2e-109  346.3   0.0      3e-40  123.7   0.3    3.6  3  XP_006522563.1  


Domain annotation for each sequence (and alignments):
>> XP_006522563.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  100.2   0.0   5.8e-33   5.8e-33       2     120 .]     142     270 ..     141     270 .. 0.96
   2 !  123.7   0.3     3e-40     3e-40       2     119 ..     615     747 ..     614     748 .. 0.98
   3 !  118.1   0.0   1.6e-38   1.6e-38       1     120 []     770     901 ..     770     901 .. 0.96

  Alignments for each domain:
  == domain 1  score: 100.2 bits;  conditional E-value: 5.8e-33
         DUF4174   2 LasfkwkrRlLlisapseedekykqqreel.eeqecelaeRklvvltivgsgaketgki.........eeeqlsaeliselrkelklsekdfsmv 86 
                     Lasf++k+R+++isap++++ +y+ +++ l ++  celaeR++  +++++++++e gk+          e++l+++li +l++ lkl++ +fsmv
  XP_006522563.1 142 LASFAGKNRVWVISAPHASEGYYRLMMSLLkDDVYCELAERHIQQIVLFHQAGEEGGKVrritnegqiLEQPLDPNLIPKLMSFLKLEKGKFSMV 236
                     89****************************559**************************99998888878888********************** PP

         DUF4174  87 LigkdggvkeryekpisleelfdlIDsmpmRqqE 120
                     L++k ++v+ery++p++le+++++ID+ p+R+ E
  XP_006522563.1 237 LLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIE 270
                     *******************************976 PP

  == domain 2  score: 123.7 bits;  conditional E-value: 3e-40
         DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeql...............saeliselrkelklsek 81 
                     L sf++krRlLli++p++e+++y qqr+e+ e+ c++a R+++v+ti+g  +++++ki++ ql               +++liselrke++++++
  XP_006522563.1 615 LGSFEGKRRLLLITTPKAENNMYVQQRDEYLESFCKMATRRISVVTIFGPVNNSSMKIDHFQLdnekpmrvvddddlvDQHLISELRKEYGMTYD 709
                     679******************************************************************************************** PP

         DUF4174  82 dfsmvLigkdggvkeryekpisleelfdlIDsmpmRqq 119
                     df mvL++ d++vk+ ye pi+++++fdlID++++R +
  XP_006522563.1 710 DFFMVLTDVDLRVKQYYEVPIAMKSVFDLIDTFQSRIK 747
                     ************************************86 PP

  == domain 3  score: 118.1 bits;  conditional E-value: 1.6e-38
         DUF4174   1 fLasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgki...........eeeqlsaeliselrkelklsekdfs 84 
                     fL++f+w+rRlL+isap++ed+ y+qq+++l++q+c++  R++++l+++g g++  g +           e+e+++a+l++++r+++++s+++fs
  XP_006522563.1 770 FLSRFRWRRRLLVISAPNDEDWAYSQQLSALNGQACNFGLRHITILKLLGVGEEVGGVLelfpingssivEREDVPAHLVKDIRNYFQVSPEYFS 864
                     699***********************************************9998877669999999999988999******************** PP

         DUF4174  85 mvLigkdggvkeryekpi.sleelfdlIDsmpmRqqE 120
                     m+L+gkdg+vk +y++p+ s+  ++dlIDsm++R+qE
  XP_006522563.1 865 MLLVGKDGNVKSWYPSPMwSMVIVYDLIDSMQLRRQE 901
                     ************************************9 PP



Or compare XP_006522563.1 to CDD or PaperBLAST