PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::Dino:3607309 to PF13778 (DUF4174)

reanno::Dino:3607309 has 149 amino acids

Query:       DUF4174  [M=120]
Accession:   PF13778.6
Description: Domain of unknown function (DUF4174)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    1.3e-24   73.2   0.0    7.5e-24   70.8   0.0    1.8  1  reanno::Dino:3607309  


Domain annotation for each sequence (and alignments):
>> reanno::Dino:3607309  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.8   0.0   7.5e-24   7.5e-24       2     120 .]      39     140 ..      38     140 .. 0.94

  Alignments for each domain:
  == domain 1  score: 70.8 bits;  conditional E-value: 7.5e-24
               DUF4174   2 LasfkwkrRlLlisapseedekykqqreeleeqecelaeRklvvltivgsgaketgkieeeqlsaeliselrkelklsekdfsmvLigk 90 
                           L++f w  R+++++a + +d+++ +q+  le++ ++la R++vv++ +               +++  selr +l+     f mv++gk
  reanno::Dino:3607309  39 LNDFLWVARPVVVFADTPADPRFVEQMTLLEARIEDLAVRDVVVIVDT---------------DPDAKSELRTKLRP--RGFMMVIVGK 110
                           899***************************************999833...............67888999988876..88******** PP

               DUF4174  91 dggvkeryekpisleelfdlIDsmpmRqqE 120
                           dggvk+r+++p ++ e+ + ID+mp+Rq+E
  reanno::Dino:3607309 111 DGGVKLRKPSPWTVREITRQIDKMPLRQEE 140
                           ****************************98 PP



Or compare reanno::Dino:3607309 to CDD or PaperBLAST