P82604 has 351 amino acids
Query: DUF4188 [M=118] Accession: PF13826.10 Description: Domain of unknown function (DUF4188) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-16 46.9 1.6 1.1e-12 34.5 0.2 2.4 2 P82604 Domain annotation for each sequence (and alignments): >> P82604 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 11.4 0.1 1.6e-05 1.6e-05 51 110 .. 72 129 .. 19 134 .. 0.79 2 ! 34.5 0.2 1.1e-12 1.1e-12 35 115 .. 234 325 .. 220 329 .. 0.81 Alignments for each domain: == domain 1 score: 11.4 bits; conditional E-value: 1.6e-05 DUF4188 51 srevllvqYwrsveeLeafAkseeHreawrefnkkvkkngavgifHEtYvveagayesiY 110 ++ ++ Yw + e +++ ++e +++w+ kk+ +n+ +g + E+ +++ ++ e++ P82604 72 YQDSIFLAYWDEPETFKSWVADPEVQKWWSG--KKIDENSPIGYWSEVTTIPIDHFETLH 129 46678899****************9999986..6699***********999999999876 PP == domain 2 score: 34.5 bits; conditional E-value: 1.1e-12 DUF4188 35 ekk.elGlLgaeslil......asrevllvqYwrsveeLeafAk.seeHreawrefnkkvkk...ngavgifHEtYvveagayesiYvnmpp 115 e+ e+G+++++ + ++ +++ Y+ s+ +Le++++ +++H+ + +f++++k+ + +++++HE+ v++++ +e iYvn++p P82604 234 ENAsETGCISSKLVYEqthdgeIVDKSCVIGYYLSMGHLERWTHdHPTHKAIYGTFYEMLKRhdfKTELALWHEVSVLQSKDIELIYVNCHP 325 4444778887777663356666668899****************8899*********99998566789**********************64 PP
Or compare P82604 to CDD or PaperBLAST