PaperBLAST – Find papers about a protein or its homologs

 

Align NP_055625.4 to PF14309 (DUF4378)

NP_055625.4 has 3117 amino acids

Query:       DUF4378  [M=165]
Accession:   PF14309.6
Description: Domain of unknown function (DUF4378)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.4e-10   26.1   1.2    5.4e-10   26.1   1.2    3.8  3  NP_055625.4  


Domain annotation for each sequence (and alignments):
>> NP_055625.4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.2   0.3      0.26      0.26      97     141 ..     647     734 ..     588     741 .. 0.57
   2 ?   -3.8   0.2      0.84      0.84     102     146 ..    2665    2703 ..    2649    2721 .. 0.57
   3 !   26.1   1.2   5.4e-10   5.4e-10      52     164 ..    2964    3098 ..    2923    3099 .. 0.84

  Alignments for each domain:
  == domain 1  score: -2.2 bits;  conditional E-value: 0.26
      DUF4378  97 rkkklsgeqLleevwseie.......................................ewlsse......elvvde....lvdkdlsrrsgkwl 141
                   ++++s+ + l+e +s++                                             +      ++++ e    l +kdl+++   w+
  NP_055625.4 647 PPSEPSATRRLQETYSKLLlektlleepshqhvtqetqakpgyqpsgesdkenkvqerP----PsassssDMSLSEppqpLARKDLMES--TWM 734
                  44455555555555555554444444444444444444444444444444433333320....13333336666667777778888777..777 PP

  == domain 2  score: -3.8 bits;  conditional E-value: 0.84
      DUF4378  102 sgeqLleevwseieewlsseelvvdelvdkdlsrrsgkwldlede 146 
                   ++++L+ +  ++++     e+ ++d+  +++l+++ +   ++ +e
  NP_055625.4 2665 ENKDLISDATEKVSI--AAEDDTLDNTFSEELEKQ-Q---QFTEE 2703
                   456666666666665..445788888888888877.3...33333 PP

  == domain 3  score: 26.1 bits;  conditional E-value: 5.4e-10
      DUF4378   52 krreerserklLFDlvneiLaeilalelkrslaepsskvssakkr.rkkklsgeqLleevwseie.................ewlsse......el 123 
                   +++ +r  ++ +FDl  ei  ei+a    +    +++k ++ +++  ++ +++ + l+e+ s i                  +w+++         
  NP_055625.4 2964 ESTSKRVYKQAVFDLTKEIFEEIFAEDP-NLNQPVWMKPCRINSSyFRR-VKNPNNLDEIKSFIAsevlklfslkkepnhktDWQKMMkfgrkkRD 3057
                   45689999***************99775.33556777777777776666.7888889********9999999888888888856666578889899 PP

      DUF4378  124 vvdelvdkdlsrrsgkwldledevdeigleierlilkdLve 164 
                    vd+++ ++l +++ +w++++++  ++ +++++ i+++L+ 
  NP_055625.4 3058 RVDHILVQELHEEEAQWVNYDEDELCVKMQLADGIFETLIK 3098
                   9**************************************97 PP



Or compare NP_055625.4 to CDD or PaperBLAST