PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001025053.1 to PF15735 (DUF4683)

NP_001025053.1 has 1603 amino acids

Query:       DUF4683  [M=400]
Accession:   PF15735.5
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.9e-16   44.5   0.3    1.7e-15   43.6   0.3    1.4  1  NP_001025053.1  


Domain annotation for each sequence (and alignments):
>> NP_001025053.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   43.6   0.3   1.7e-15   1.7e-15     341     400 .]     583     642 ..     566     642 .. 0.90

  Alignments for each domain:
  == domain 1  score: 43.6 bits;  conditional E-value: 1.7e-15
         DUF4683 341 lsvkRkrssaslsppqpsynaetedagleYkDvmskLGfLserspspvasspprCwsptd 400
                        kR+r ++ l++pqpsy a ++d + eY+Dv+ kL fL  +s  +   spprCw p++
  NP_001025053.1 583 EVKKRRRRKQKLASPQPSYAADANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPSE 642
                     4568999999***********************************************985 PP



Or compare NP_001025053.1 to CDD or PaperBLAST