NP_001025053.1 has 1603 amino acids
Query: DUF4683 [M=411]
Accession: PF15735.9
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-16 45.1 0.4 1.2e-15 44.1 0.4 1.4 1 NP_001025053.1
Domain annotation for each sequence (and alignments):
>> NP_001025053.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.1 0.4 1.2e-15 1.2e-15 353 410 .. 584 641 .. 570 642 .. 0.91
Alignments for each domain:
== domain 1 score: 44.1 bits; conditional E-value: 1.2e-15
DUF4683 353 lsfrkrssailsppqpsysaeaeDcdlnysdvmsklGflserslspvelspPrCwsps 410
++ r+r ++ l pqpsy+a a+D++ +ysdv+ kl fl +s + + spPrCw ps
NP_001025053.1 584 VKKRRRRKQKLASPQPSYAADANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPS 641
4558999999**********************************************98 PP
Or compare NP_001025053.1 to CDD or PaperBLAST