PaperBLAST – Find papers about a protein or its homologs

 

Align NP_002903.3 to PF15735 (DUF4683)

NP_002903.3 has 3130 amino acids

Query:       DUF4683  [M=400]
Accession:   PF15735.5
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   6.2e-169  548.8  13.4   6.2e-169  548.8  13.4    4.8  6  NP_002903.3  


Domain annotation for each sequence (and alignments):
>> NP_002903.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -6.0   3.9         1         1      66     150 ..     275     363 ..     268     394 .. 0.61
   2 ?   -5.8   4.9         1         1      87     138 ..     586     635 ..     451     716 .. 0.63
   3 !  548.8  13.4  6.2e-169  6.2e-169       2     400 .]     747    1133 ..     746    1133 .. 0.97
   4 ?   -5.5   8.9         1         1      69     140 ..    1161    1228 ..    1153    1266 .. 0.36
   5 ?    0.3   3.7     0.024     0.024      78     169 ..    1516    1610 ..    1494    1643 .. 0.54
   6 ?   -5.9   2.3         1         1     102     160 ..    1700    1757 ..    1692    1786 .. 0.51

  Alignments for each domain:
  == domain 1  score: -6.0 bits;  conditional E-value: 1
      DUF4683  66 kk.alkklaevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlskd...vkvaeeask 150
                  ++ +++  ++ + +   + + +s+ k++k+ +++ ++++ + + + + + ++ ++++  + +l++++ + +  + ++   v+v++++++
  NP_002903.3 275 RNeTSQMSQPESQDHRFVPATESEKKFQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPanmVEVHKDKES 363
                  23355555666666666677777777777777777777777777767777677778888888888887777777776323333333222 PP

  == domain 2  score: -5.8 bits;  conditional E-value: 1
      DUF4683  87 srlklgkkkeklvekrekeeeeedkastkekeksylqknalsksis.etdkvl 138
                  s+  l+k++  l e   +++++++k    ++ +s++++++ s + + + ++++
  NP_002903.3 586 SSHVLNKED--LIEDLSQTNKNTEKGLD-NSVTSFTNESTYSMKYPgSLSSTV 635
                  333334433..22222222222222222.233444444444433332222222 PP

  == domain 3  score: 548.8 bits;  conditional E-value: 6.2e-169
      DUF4683    2 lfseedvdnvvsdddssteesdvnklkiRyEefqenktektsvaQqeahykFFPSVvlsnClkrkkalkklaevtyklqqfkkkqsrlklgkkkek 97  
                   l+++++++++v++ +s+++es +nklkiRyEefqe+ktek+s++Qq+ahy+FFPSVvlsnCl+r   ++kl++vtyklq + +k srlkl+k+k  
  NP_002903.3  747 LSCSGENRTMVHSLNSTADESGLNKLKIRYEEFQEHKTEKPSLSQQAAHYMFFPSVVLSNCLTR---PQKLSPVTYKLQPG-NKPSRLKLNKRK-- 836 
                   79**************************************************************...**************.8**********9.. PP

      DUF4683   98 lvekrekeeeeedkastkekeksylqknalsksisetdkvlskd.vkvaeeaskskalleeansaslefeddseesekassligskYtLRaKRKvr 192 
                   l++++e++++++++    +++ +++q+n+++ s++e+d++l++d +k++++a+++k+++    + +++f d++ e+e++++l+g+kYtLRaKRKv+
  NP_002903.3  837 LAGHQETSTKSSETG---STKDNFIQNNPCN-SNPEKDNALASDlTKTTRGAFENKTPT--DGFIDCHFGDGTLETEQSFGLYGNKYTLRAKRKVN 926 
                   889988888666644...45677********.88999999999999***********96..5599******************************* PP

      DUF4683  193 yeeeDseesekiknkkeslpqeekeeddvegsqkskKrrkvsrkePPvIIKYIIiNRFkGrKnmLVKlskvdssEeqvtLteeklekYkkLAPLKd 288 
                   ye+eDse+s+ ++n+k+slp++++  ++ +g+ ks+Krrk+s+k+PPvIIKYIIiNRF+GrKnmLVKl+k+ds+E+qv+Lteek+e+YkkLAPLKd
  NP_002903.3  927 YETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKD 1022
                   ************************************************************************************************ PP

      DUF4683  289 FWpkvpesratkypileltaKkshkrKaKvksakkkriqrlkkiekkvlkrtlsvkRkrssaslsppqpsynaetedagleYkDvmskLGfLsers 384 
                   FWpkvp+s+atkypi++lt+Kksh+rK+K+ksakkk++ + ++++++++krtls+++krs+a+lspp+psynaeted++l+Y+DvmskLGfLsers
  NP_002903.3 1023 FWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTG-KQQRTNNENIKRTLSFRKKRSHAILSPPSPSYNAETEDCDLNYSDVMSKLGFLSERS 1117
                   *************************************9.99******************************************************* PP

      DUF4683  385 pspvasspprCwsptd 400 
                   +sp++sspprCwsptd
  NP_002903.3 1118 TSPINSSPPRCWSPTD 1133
                   **************98 PP

  == domain 4  score: -5.5 bits;  conditional E-value: 1
      DUF4683   69 lkklaevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlsk 140 
                   ++++++++    q+kk++ +l      +k  +kr+++++  d+ ++    k  +++++ +k +s + ++l+ 
  NP_002903.3 1161 NSRIGKTSRARAQIKKSKAKLANPSIVTKKRNKRNQTNKLVDDGKK----KPRAKQKTNEKGTSRKHTTLKD 1228
                   5555555555555533332222111111111222222222221111....1111111111111111111111 PP

  == domain 5  score: 0.3 bits;  conditional E-value: 0.024
      DUF4683   78 klqqfkkkqsrlklgkkkeklvek.rekeeeeedkastkekeksylqknalsksisetdkvlskd..vkvaeeaskskalleeansaslefedds 169 
                   + + f + qs l + k+  +  ++  +++++++d  s+k++ +++++++  +++ +++ ++++++   ++ +++++++++ +   ++sl+ ++ s
  NP_002903.3 1516 TPSAFGEGQSGLAVLKELLQKRQQkAQNANTTQDPLSNKHQPNKNISGSLEHNKANKRTRSVTSPrkPRTPRSTKQKEKIPKLLKVDSLNLQNSS 1610
                   33444456666666666655444423444455666666666666666555444444444443333333445555555554444444444444444 PP

  == domain 6  score: -5.9 bits;  conditional E-value: 1
      DUF4683  102 rekeeeeedkastkekeksylqknalsksisetdkvlskdvkvaeeaskskal.leeans 160 
                    +++   edk++t  ++ s++++ +ls +i e+++  s++ + +++ ++s ++ ++ +ns
  NP_002903.3 1700 DNQKC-DEDKHHT-TDSASWIRSGTLSPEIFEKSTIDSNENRRHNQWKNSFHPlTTRSNS 1757
                   33333.4554444.5666688888888888888888877733222222222220223333 PP



Or compare NP_002903.3 to CDD or PaperBLAST