Q6PAL7 has 1594 amino acids
Query: DUF4683 [M=411]
Accession: PF15735.9
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.8e-16 45.4 0.3 9.1e-16 44.5 0.3 1.4 1 Q6PAL7
Domain annotation for each sequence (and alignments):
>> Q6PAL7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.5 0.3 9.1e-16 9.1e-16 352 410 .. 580 638 .. 563 639 .. 0.90
Alignments for each domain:
== domain 1 score: 44.5 bits; conditional E-value: 9.1e-16
DUF4683 352 tlsfrkrssailsppqpsysaeaeDcdlnysdvmsklGflserslspvelspPrCwsps 410
+++ r+r ++ l pqpsy+a a+D++ +ysdv+ kl fl +s + + spPrCw ps
Q6PAL7 580 EVKKRRRRKQKLASPQPSYAADANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPS 638
4556999999***********************************************98 PP
Or compare Q6PAL7 to CDD or PaperBLAST