PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006528097.1 to PF15735 (DUF4683)

XP_006528097.1 has 1515 amino acids

Query:       DUF4683  [M=400]
Accession:   PF15735.5
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.7e-119  386.0  20.3   1.7e-119  386.0  20.3    3.4  4  XP_006528097.1  


Domain annotation for each sequence (and alignments):
>> XP_006528097.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  386.0  20.3  1.7e-119  1.7e-119       1     391 [.     284     681 ..     284     690 .. 0.90
   2 ?   -1.2   1.8     0.069     0.069      80     159 ..     725     800 ..     701     810 .. 0.54
   3 ?   -4.8   2.3      0.83      0.83     124     169 ..     847     892 ..     815     925 .. 0.48
   4 ?   -1.9   2.3      0.11      0.11      64     100 ..    1174    1211 ..    1154    1258 .. 0.57

  Alignments for each domain:
  == domain 1  score: 386.0 bits;  conditional E-value: 1.7e-119
         DUF4683   1 nlfseedvdnvvsdddssteesdvnklkiRyEefqenktektsva.QqeahykFFPSVvlsnClkrkkalkklaevtyklqqfkkkqsrlklgkk 94 
                     nlfseedv+n+++ddd+st +sdv++lkiRyE+fq+n+++kt+++ Q++a+++FFPSV +++C+kr ++++ + + +++l+qfk ++ ++++g++
  XP_006528097.1 284 NLFSEEDVENYMFDDDESTLGSDVCSLKIRYESFQDNVRDKTTLLmQEDAQFNFFPSV-FTTCPKR-ESKSGILKQSSDLSQFKVPDVSIIWGEE 376
                     79****************************************9888************.*******.55555667799***************** PP

         DUF4683  95 keklvekrekeeeeedkastkekeksylqknals.ksisetdkvlskdvkvaeeaskskalleeansaslefedds...eeseka.......... 175
                     +++l++k+ kee +edk+ ++++ek + +k al+ k++   ++++ k+        k ++l+++ + +s++f+dds   e s++a          
  XP_006528097.1 377 DKNLDKKKGKEEVHEDKSIETKDEKDNGEKPALNnKPCGGLEVEQFKN-------LKADQLTNSLE-TSGNFSDDSsfiEVSYDAmgeikdcsry 463
                     ********************************9725677888888888.......45555544444.4788888888888888889999999999 PP

         DUF4683 176 ........ssligskYtLRaKRKvryeee.....DseesekiknkkeslpqeekeeddvegsqkskKrrkvsrkePPvIIKYIIiNRFkGrKnmL 257
                             ss+++++Y+LRaKRKvry+e+     Ds e ek++++ke+ p ++keedd+e+++  kKrrkv+rkePPvIIKYIIiNRFkG+KnmL
  XP_006528097.1 464 mardtnsgSSSSQQNYGLRAKRKVRYSEDylydvDSLEGEKVNERKEWPPGGSKEEDDDEWCP--KKRRKVTRKEPPVIIKYIIINRFKGEKNML 556
                     ******99*******************************************************..****************************** PP

         DUF4683 258 VKlskvdssEeqvtLteeklekYkkLAPLKdFWpkvpesr..atkypileltaKks............hkrKaKvksakkkriqrlkkiekkvlk 338
                     VKlskvd+sE++v+L+e++l+kY+kL PLK+FW+k+++++  +t++++++l++K+s            ++rK+K+k  +++riqr++++e++ ++
  XP_006528097.1 557 VKLSKVDASETTVNLSENQLSKYAKLSPLKGFWQKKKKQKnsNTDSVKTPLCQKQSfepgsfevsflpPARKRKSKLGNRHRIQRIQSVETSASS 651
                     **********************************9887765589*************************************************** PP

         DUF4683 339 rtlsvkRkrssaslsppqpsynaetedagleYkDvmskLGfLserspspvass 391
                     +++s+       +++++q++   ++ed  +              ++p+++ ++
  XP_006528097.1 652 KQVSF-------CSDQKQACN--RKEDGVK--------------GTPKSALLT 681
                     ****8.......999999996..6666544..............455555555 PP

  == domain 2  score: -1.2 bits;  conditional E-value: 0.069
         DUF4683  80 qqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlskdvkvaeeaskskalleean 159
                     +  + k++++k g++++ +v+    +e   d++s+ + +++ +++++ s+++se  +++ k+ +   ++ +s+++l++an
  XP_006528097.1 725 EA-RLKSKKIKAGQENKPVVQMSPVSE---DTSSKANLKNEVTPGTSNSSHMSEFHETKVKNSTFLPTTCSSEMPLSSAN 800
                     22.234555555555555554444444...33333334555566666666666666666666455555555555555555 PP

  == domain 3  score: -4.8 bits;  conditional E-value: 0.83
         DUF4683 124 knalsksisetdkvlskdvkvaeeaskskalleeansaslefedds 169
                     ++a    +s +d vls++   + ++s+++  +e +n+ sl  + d+
  XP_006528097.1 847 EKAFVPLQSAQDCVLSSSSDSQLQQSSQNFKMEASNFGSLWPDKDT 892
                     2222223333333333333333333344444444444333333333 PP

  == domain 4  score: -1.9 bits;  conditional E-value: 0.11
         DUF4683   64 krkk.alkklaevtyklqqfkkkqsrlklgkkkeklve 100 
                      +rkk ++ k + v+  ++q ++++++ k ++k  +   
  XP_006528097.1 1174 SRKKtSPGKSGAVSQSSSQKNSRKKSPKASNKGVEKPP 1211
                      33333555555555555555444444444444321111 PP



Or compare XP_006528097.1 to CDD or PaperBLAST