PaperBLAST – Find papers about a protein or its homologs

 

Align XP_008771572.1 to PF15735 (DUF4683)

XP_008771572.1 has 1517 amino acids

Query:       DUF4683  [M=400]
Accession:   PF15735.5
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.2e-117  380.0  18.2   1.2e-117  380.0  18.2    3.4  3  XP_008771572.1  


Domain annotation for each sequence (and alignments):
>> XP_008771572.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  380.0  18.2  1.2e-117  1.2e-117       1     358 [.     284     664 ..     284     676 .. 0.92
   2 ?   -7.2   7.5         1         1     150     157 ..     793     800 ..     704     900 .. 0.52
   3 ?   -1.6   1.4     0.088     0.088      65     136 ..    1177    1211 ..    1156    1250 .. 0.52

  Alignments for each domain:
  == domain 1  score: 380.0 bits;  conditional E-value: 1.2e-117
         DUF4683   1 nlfseedvdnvvsdddssteesdvnklkiRyEefqenktektsva.QqeahykFFPSVvlsnClkrkkalkklaevtyklqqfkkkqsrlklgkk 94 
                     nlfseedv+n+++ddd+st +sdv++lkiRyE+fq+n+++kt+++ Q++a+++FFPSV +++C+kr ++++ + + +++l+qfk ++ ++++g++
  XP_008771572.1 284 NLFSEEDVENYMFDDDESTLGSDVCSLKIRYESFQDNVRDKTTLLmQEDAQFNFFPSV-FTTCPKR-ESKSGVLKQSSDLSQFKVPDVSIIWGDE 376
                     79****************************************9888************.*******.44445556799***************** PP

         DUF4683  95 keklvekrekeeeeedkastkekeksylqknals.ksisetdkvlskdvkvaeeaskskalleeansaslefedds...eeseka.......... 175
                     +++l++k+ kee +edk+ +k++ek + +k al+ k++s  ++++ k+        k ++l+++ + +s++f+dds   e s++a          
  XP_008771572.1 377 DKNLDKKKGKEEVHEDKSIEKKDEKDNGEKPALNnKPCSGLEVEQFKN-------LKPDHLTNSLE-TSGNFSDDSsfiEVSYDAmgeikdcsry 463
                     ************9*******************9726678888888888.......55666654444.4888898888888899999999999999 PP

         DUF4683 176 ........ssligskYtLRaKRKvryeee.....DseesekiknkkeslpqeekeeddvegsqkskKrrkvsrkePPvIIKYIIiNRFkGrKnmL 257
                             ss+++++Y+LRaKRKvry+e+     Ds e ek++++ke+ p ++keedd+e+++  kKrrkv+rkePPvIIKYIIiNRFkG+KnmL
  XP_008771572.1 464 mardtnsgSSSSQQNYGLRAKRKVRYSEDylydvDSLEGEKVNERKEWPPGGSKEEDDDEWCP--KKRRKVTRKEPPVIIKYIIINRFKGEKNML 556
                     ******99*******************************************************..****************************** PP

         DUF4683 258 VKlskvdssEeqvtLteeklekYkkLAPLKdFWpkvpesr..atkypileltaKks............hkrKaKvksakkkriqrlkkiekkvlk 338
                     VKl+kvd+sE++v+L+e +l+kY+kL PLK+FW+k+++++  +t+++++++++K+s            ++rK+K+k  +++riqr++++e++ ++
  XP_008771572.1 557 VKLGKVDASETTVNLSESQLSKYAKLSPLKGFWQKKKKQKngNTDSVKTPFCQKQSfepgsfevsflpPARKRKSKLGNRHRIQRIQSMEASASS 651
                     **********************************999887668**************************************************** PP

         DUF4683 339 rtlsvkRkrssaslsppqps 358
                     +++s+   +++a       s
  XP_008771572.1 652 KQVSFGSDQKQA-------S 664
                     **9984444333.......3 PP

  == domain 2  score: -7.2 bits;  conditional E-value: 1
         DUF4683 150 kskallee 157
                     +s+++l++
  XP_008771572.1 793 SSEMPLSS 800
                     22333333 PP

  == domain 3  score: -1.6 bits;  conditional E-value: 0.088
         DUF4683   65 rkk.alkklaevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdk 136 
                      rkk ++ k + v+  ++q ++++++ k ++k                                        +k
  XP_008771572.1 1177 RKKtSPGKSGAVSQSSSQKNTRKKSPKASNKGV--------------------------------------EK 1211
                      322244444444444444444444444333331......................................11 PP



Or compare XP_008771572.1 to CDD or PaperBLAST