PaperBLAST – Find papers about a protein or its homologs

 

Align XP_015140065.1 to PF15735 (DUF4683)

XP_015140065.1 has 3167 amino acids

Query:       DUF4683  [M=400]
Accession:   PF15735.5
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
     1e-174  567.9  11.9     1e-174  567.9  11.9    5.5  6  XP_015140065.1  


Domain annotation for each sequence (and alignments):
>> XP_015140065.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?  -18.0  18.1         1         1     153     153 ..     488     488 ..     269     682 .. 0.59
   2 !  567.9  11.9    1e-174    1e-174       2     400 .]     749    1139 ..     747    1139 .. 0.98
   3 ?   -4.9  10.9      0.86      0.86      73     140 ..    1174    1241 ..    1157    1271 .. 0.43
   4 ?   -2.0   0.6      0.12      0.12     283     342 ..    1539    1599 ..    1534    1645 .. 0.65
   5 ?   -2.3   1.3      0.14      0.14     135     169 ..    1741    1776 ..    1689    1878 .. 0.57
   6 ?   -6.8   4.7         1         1      69     181 ..    2002    2112 ..    1995    2155 .. 0.39

  Alignments for each domain:
  == domain 1  score: -18.0 bits;  conditional E-value: 1
         DUF4683 153 a 153
                     +
  XP_015140065.1 488 S 488
                     1 PP

  == domain 2  score: 567.9 bits;  conditional E-value: 1e-174
         DUF4683    2 lfseedvdnvvsdddssteesdvnklkiRyEefqenktektsvaQqeahykFFPSVvlsnClkrkkalkklaevtyklqqfkkkqsrlklgkk 94  
                      +++++ +++vv++ +++t+e+ +nklkiRyEefqe+k+ek+s++Qq+ahy+FFPSVvlsnCl+r   ++kla+vtyklqq+ +kqsrlkl+kk
  XP_015140065.1  749 VSCSGGSRTVVHSLENNTDEGGLNKLKIRYEEFQEHKAEKPSLSQQAAHYMFFPSVVLSNCLSR---PQKLAPVTYKLQQG-NKQSRLKLNKK 837 
                      589*************************************************************...**************.8********** PP

         DUF4683   95 keklvekrekeeeeedkastkekeksylqknalsksisetdkvlskd.vkvaeeaskskalleeansaslefeddseesekassligskYtLR 186 
                      k ++ +++e+++ ++d  s+  ke++y+q+na+s +i+++d++l +d v+v  e++++k+++++a ++++++ d+s e+e++++l+g+kYtLR
  XP_015140065.1  838 KYSFINHQEPAT-VSDVVSV--KESCYTQGNACS-NIPDKDSALPSDlVQVPLESFENKMPTSTAHCTDCQIGDGSLETEQSFGLCGNKYTLR 926 
                      *********999.9998887..9***********.********************************************************** PP

         DUF4683  187 aKRKvryeeeDseesekiknkkeslpqeekeeddvegsqkskKrrkvsrkePPvIIKYIIiNRFkGrKnmLVKlskvdssEeqvtLteeklek 279 
                      +KRKv+ye+eDse+s+ ++n+k++lpq+ ++ ++ +gsqks+Krr++s+k+PPvIIKYIIiNRF+GrKnmLVKl+kvdssEe+v+Lteek+++
  XP_015140065.1  927 TKRKVNYETEDSESSFVAHNSKINLPQPIESVESLDGSQKSRKRRRLSKKLPPVIIKYIIINRFRGRKNMLVKLGKVDSSEERVVLTEEKMNL 1019
                      ********************************************************************************************* PP

         DUF4683  280 YkkLAPLKdFWpkvpesratkypileltaKkshkrKaKvksakkkriqrlkkiekkvlkrtlsvkRkrssaslsppqpsynaetedagleYkD 372 
                      Y+kLAPLKdFWpkvp+s+atkypi++lt+KkshkrKaK+ks+kkk+++  ++ +k+++krtls+ Rkr++++lspp+psynae+ed++ +Y+D
  XP_015140065.1 1020 YRKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHKRKAKHKSTKKKAGKLQRTGSKNNIKRTLSF-RKRTHTILSPPSPSYNAEAEDCDYNYSD 1111
                      ***********************************************5555567778999**99.**************************** PP

         DUF4683  373 vmskLGfLserspspvasspprCwsptd 400 
                      vmskLGfLsers+spv++spprCwsptd
  XP_015140065.1 1112 VMSKLGFLSERSTSPVNTSPPRCWSPTD 1139
                      **************************98 PP

  == domain 3  score: -4.9 bits;  conditional E-value: 0.86
         DUF4683   73 aevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlsk 140 
                      ++ +++++++kkk  +  ++ kk+k  ++ +k+++   k+  ++++++ ++k ++ k +  +d++ ++
  XP_015140065.1 1174 SRAKTQVKKCKKKFASPTVSTKKKKKMNQSDKTADDGKKKPRTKQRQKTTEKMSSRKRMVFKDEKGNN 1241
                      33444444444444444433333333333333333333333333333334443333333333322222 PP

  == domain 4  score: -2.0 bits;  conditional E-value: 0.12
         DUF4683  283 LAPLKdFWpkvpesr.atkypileltaKkshkrKaKvksakkkriqrlkkiekkvlkrtls 342 
                      LA LK+  +k++++  + ++ + +l  K +  r + +   + k+i+r ++   ++ +  + 
  XP_015140065.1 1539 LAVLKELLQKRQQKAqNANVTQEPLPVKTQLSRGTPCPLEQNKAIKRSRSATPRKPRAPRN 1599
                      8899999999988764677778888888886777777666666665544433333222222 PP

  == domain 5  score: -2.3 bits;  conditional E-value: 0.14
         DUF4683  135 dkvlskdvkvaeeaskskal.leeansaslefedds 169 
                       +  s++ + +++  k+ ++ ++ +ns +++  +++
  XP_015140065.1 1741 TSLDSNENHCHSQRRKNVHPsTSRSNSIDTSCTQET 1776
                      222222222222222221110111122111111111 PP

  == domain 6  score: -6.8 bits;  conditional E-value: 1
         DUF4683   69 lkklaevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlskdvkvaeeaskskalleeans. 160 
                       kk++ + +k   + ++q ++ l+ k+e  + kr +++  +    + ek+ ++ +++ ls + s++ ++ +kd ++ +  +  + ++ +++s 
  XP_015140065.1 2002 DKKIVIMPCKCAPS-QQQVQIWLHAKEEYEHFKRLPKN--HP--AELEKAAENFSSTVLSGEKSSEVVKAAKDLNLSSL-EDGRPIVPTKDSp 2088
                      55666666666666.45566555555533333333333..22..22224444444444443333222222233222111.1122222233332 PP

         DUF4683  161 ...aslefeddseesekassligs 181 
                         a+    +  e++ k++s+ig 
  XP_015140065.1 2089 asvADPTKAQTKETCDKSVSTIGA 2112
                      111111222222444444444443 PP



Or compare XP_015140065.1 to CDD or PaperBLAST