PaperBLAST – Find papers about a protein or its homologs

 

Align XP_017169343.1 to PF15735 (DUF4683)

XP_017169343.1 has 2845 amino acids

Query:       DUF4683  [M=400]
Accession:   PF15735.5
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   3.8e-163  529.8  11.4   3.8e-163  529.8  11.4    4.9  5  XP_017169343.1  


Domain annotation for each sequence (and alignments):
>> XP_017169343.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -9.4   7.7         1         1     125     125 ..     514     514 ..     443     688 .. 0.60
   2 !  529.8  11.4  3.8e-163  3.8e-163       3     400 .]     748    1133 ..     746    1133 .. 0.96
   3 ?   -7.6  10.1         1         1      71     141 ..    1164    1232 ..    1153    1274 .. 0.40
   4 ?  -13.9  16.1         1         1      78     133 ..    1515    1570 ..    1292    1618 .. 0.71
   5 ?   -4.0   0.8      0.48      0.48     105     146 ..    1753    1793 ..    1722    1821 .. 0.59

  Alignments for each domain:
  == domain 1  score: -9.4 bits;  conditional E-value: 1
         DUF4683 125 n 125
                     +
  XP_017169343.1 514 S 514
                     1 PP

  == domain 2  score: 529.8 bits;  conditional E-value: 3.8e-163
         DUF4683    3 fseedvdnvvsdddssteesdvnklkiRyEefqenktektsvaQqeahykFFPSVvlsnClkrkkalkklaevtyklqqfkkkqsrlklgkkk 95  
                       s+++++++ ++ +s t+es +nklkiRyEefqe+k ek+s++Qq+ahy+FFPSVvlsnCl+r   ++kl++vtyklq + +k srlkl+kkk
  XP_017169343.1  748 PSSGENRSMAHSLESITDESGLNKLKIRYEEFQEHKMEKPSLSQQAAHYMFFPSVVLSNCLTR---PQKLSPVTYKLQSG-NKPSRLKLNKKK 836 
                      578999*********************************************************...**************.8*********** PP

         DUF4683   96 eklvekrekeeeeedkastkekeksylqknalsksisetdkvlskd.vkvaeeaskskalleeansaslefeddseesekassligskYtLRa 187 
                        l + +e++++++++  t  k+++  ++n l    se+++ ls+d  k +++++++k ++  + + +++f d+s e+e++++l+g+kYtLRa
  XP_017169343.1  837 --LIGLQETSTKSTETGAT--KDSC--THNDLYTGASEKENGLSSDsAKATHGTFENKPPT--EHFIDCHFGDGSLEAEQSFGLYGNKYTLRA 921 
                      ..78888888866775555..6675..67777778999999999998999*********95..6799************************** PP

         DUF4683  188 KRKvryeeeDseesekiknkkeslpqeekeeddvegsqkskKrrkvsrkePPvIIKYIIiNRFkGrKnmLVKlskvdssEeqvtLteeklekY 280 
                      KRKv+ye+eDse+s+ ++n+k+slp++++  ++ +g+ ks+Krrk+s+k+PPvIIKYIIiNRF+GrKnmLVKl+k+ds+E+qv+Lteek+e+Y
  XP_017169343.1  922 KRKVNYETEDSESSFVTQNSKISLPHPMEIGENLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELY 1014
                      ********************************************************************************************* PP

         DUF4683  281 kkLAPLKdFWpkvpesratkypileltaKkshkrKaKvksakkkriqrlkkiekkvlkrtlsvkRkrssaslsppqpsynaetedagleYkDv 373 
                      kkLAPLKdFWpkvp+s+atkypi++lt+Kksh+rK+K+ksakkk + + ++++++++krtls+++kr++a+lspp+psy aeted++l Y+Dv
  XP_017169343.1 1015 KKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKPG-KQHRTNSENIKRTLSFRKKRTHAVLSPPSPSYIAETEDCDLSYSDV 1106
                      *********************************************9.99******************************************** PP

         DUF4683  374 mskLGfLserspspvasspprCwsptd 400 
                      mskLGfLsers+sp++sspprCwsptd
  XP_017169343.1 1107 MSKLGFLSERSTSPINSSPPRCWSPTD 1133
                      *************************98 PP

  == domain 3  score: -7.6 bits;  conditional E-value: 1
         DUF4683   71 klaevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlskd 141 
                      ++++ +    q+kk++ rl  +   ++  +kr+++++  d+ +  +k ++  ++ a +ks s +    + +
  XP_017169343.1 1164 RVGKASRARAQVKKSKARLANSSVVTNKRNKRNQTTKLVDDGK--KKPRAKQKQRANEKSLSRKHAIPADE 1232
                      5555555555555444444444444444444444443333221..22222222233332222222222222 PP

  == domain 4  score: -13.9 bits;  conditional E-value: 1
         DUF4683   78 klqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksise 133 
                      + + f + qs l + k+  +  +++ +++++ ++++++++  ++++ +  +k+ ++
  XP_017169343.1 1515 TPSVFGEGQSGLAVLKELLQKRQQKAQSTNVVQDSTSTHQPDKNISVSNEHKKANK 1570
                      23333344555555555444444433333322222222333334444333333333 PP

  == domain 5  score: -4.0 bits;  conditional E-value: 0.48
         DUF4683  105 eeeeedkastkekeksylqknalsksisetdkvlskdvkvae 146 
                      +++  ++ +++++e+++++k+ l++s  ++++ ls + + ++
  XP_017169343.1 1753 SNSIMESFCVQQAENCLTEKSRLNRSSVSKEVFLSLP-QANS 1793
                      3334456677788888888888888888888777766.2222 PP



Or compare XP_017169343.1 to CDD or PaperBLAST