PaperBLAST – Find papers about a protein or its homologs

 

Align XP_018117079.1 to PF15735 (DUF4683)

XP_018117079.1 has 3109 amino acids

Query:       DUF4683  [M=400]
Accession:   PF15735.5
Description: Domain of unknown function (DUF4683)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.1e-164  534.8  14.3   1.1e-164  534.8  14.3    5.0  7  XP_018117079.1  


Domain annotation for each sequence (and alignments):
>> XP_018117079.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -6.2   5.7         1         1      68     180 ..     280     395 ..     270     487 .. 0.62
   2 ?   -4.5   2.9       0.7       0.7     123     153 ..     469     498 ..     397     580 .. 0.56
   3 ?   -2.8   0.0      0.21      0.21      78     168 ..     574     657 ..     550     670 .. 0.62
   4 !  534.8  14.3  1.1e-164  1.1e-164       7     400 .]     744    1171 ..     738    1171 .. 0.98
   5 ?   -5.0   6.6      0.94      0.94     307     352 ..    1230    1282 ..    1204    1335 .. 0.56
   6 ?   -1.7   1.2     0.097     0.097      68     208 ..    1427    1527 ..    1386    1551 .. 0.54
   7 ?   -3.6   4.7      0.37      0.37     277     342 ..    1556    1627 ..    1548    1670 .. 0.57

  Alignments for each domain:
  == domain 1  score: -6.2 bits;  conditional E-value: 1
         DUF4683  68 alkklaevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlskd..vkvaeeaskskalleeans 160
                     +++  ++ + +   +  ++s+ +l+k+ +++ ++++ + +  ++ + ++ ++++  + +l+++  + d+  s+   v v++++ ++++    ++ 
  XP_018117079.1 280 SSQISPPDSQDRGYVAMSESEKILQKRLKEILKQNDFSLTLPNSLDCSNLSEEFSVELTLHSQLDSPDVLCSQAnmVDVHRDEPQRNKGCVGEEQ 374
                     44444555666667777788888888888888888877777777666677788888888888888888887776678888888888887777777 PP

         DUF4683 161 aslefedds.eesekasslig 180
                     +++ +++++  + +++s++ +
  XP_018117079.1 375 EDAVIDEEAiLNVMETSQIFQ 395
                     777777777744444433332 PP

  == domain 2  score: -4.5 bits;  conditional E-value: 0.7
         DUF4683 123 qknalsksisetdkvlskdvkvaeeaskska 153
                      ++   ++++e++++ +   +++e++s++++
  XP_018117079.1 469 MSQRWDNNTEEHNTKRNF-KSIEESSSEDDS 498
                     111111111111111111.122222222222 PP

  == domain 3  score: -2.8 bits;  conditional E-value: 0.21
         DUF4683  78 klqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlskdvkvaeeaskskalleeansaslefedd 168
                     + q++ +  s+ +l+k+   l e+  + +ee+  +    + +s++++++++ + ++  +  +++  ++eeask++ +     ++++ fed+
  XP_018117079.1 574 QCQHT-SALSSHILKKEG--LIEELPQPAEEKGPE---LSVHSFTNDSTCNMKYPSSFNNSTCPEVLHEEASKNDIAP-VPAIDKTAFEDG 657
                     33333.333334443333..555433333233322...3468899999999999998888888856666666666553.334566677765 PP

  == domain 4  score: 534.8 bits;  conditional E-value: 1.1e-164
         DUF4683    7 dvdnvvsdddssteesdvnklkiRyEefqenktektsvaQqeahykFFPSVvlsnClkrkkalkklaevtyklqqfkkkqsrlklgkkkeklv 99  
                       ++ +++++d+++++++ nk+k R+Ee+q++ t++ts +Qq++hykFFPSVvlsnCl+r   ++kla+vtyk+qq+ kkqsrlkl+kkk  +v
  XP_018117079.1  744 VSRVMLHTADNAINDVSPNKRKARSEELQQHATDMTSGNQQATHYKFFPSVVLSNCLNR---PQKLAPVTYKVQQC-KKQSRLKLVKKK--VV 830 
                      578899*****************************************************...**************.7***********..99 PP

         DUF4683  100 ekrekeeeeed...........................................kastkekeksylqknalsksisetdkvlskd..vkvaee 147 
                      e+++++++++d                                           +++   k++sy+++na+sks +++d+v s+d  v++ ++
  XP_018117079.1  831 ENEHTSATAKDiedllgyegsveyrentnlqkqsivtgidtipspsyqdivdpiNTVG--KDSSYAPGNACSKSPPDVDRVPSCDmaVMMDDG 921 
                      9999999999999**************************************9765555..9************************9999**** PP

         DUF4683  148 askskalleeansaslefeddseesekassligskYtLRaKRKvryeeeDseesekiknkkeslpqeekeeddvegsqkskKrrkvsrkePPv 240 
                      a++s+a+  e n ++++fe ++++se++++++g+kYtLRaKRKv++e+eD+e +++++n+k+slpq+e++ ddve  qk++Krrkvs+k+PPv
  XP_018117079.1  922 AFQSNAC--ELNAFTCQFEVGATDSEPSLEICGNKYTLRAKRKVNFESEDGEPVKGATNSKSSLPQPEETMDDVESFQKVHKRRKVSNKLPPV 1012
                      *******..79********************************************************************************** PP

         DUF4683  241 IIKYIIiNRFkGrKnmLVKlskvdssEeqvtLteeklekYkkLAPLKdFWpkvpesratkypileltaKkshkrKaKvksakkkriqrlkkie 333 
                      IIKYIIiNRFkGrKnm VKl+k+d+sEeqv+Lte+k+++Y+++APLKdFWpkvpes+atkypi ++ +Kk++krK+K+ksakkk++ rl+k+e
  XP_018117079.1 1013 IIKYIIINRFKGRKNMQVKLEKLDPSEEQVKLTEDKIKQYNRMAPLKDFWPKVPESPATKYPIFPVIPKKNNKRKTKQKSAKKKTG-RLPKTE 1104
                      *************************************************************************************9.****** PP

         DUF4683  334 kkvlkrtlsvkRkrssaslsppqpsynaetedagleYkDvmskLGfLserspspvasspprCwsptd 400 
                      +k+l+r++s++Rkr++++ls p+p+ynaeted++++YkDvmskLGfL+er+psp+++spprCwsptd
  XP_018117079.1 1105 TKMLQRAVSIRRKRIRSFLSLPMPTYNAETEDCDTDYKDVMSKLGFLVERCPSPINMSPPRCWSPTD 1171
                      *****************************************************************98 PP

  == domain 5  score: -5.0 bits;  conditional E-value: 0.94
         DUF4683  307 taKks.......hkrKaKvksakkkriqrlkkiekkvlkrtlsvkRkrssasl 352 
                      ++Kk        + +K+K ks  kk  +  +k  k + k+t    R  +++sl
  XP_018117079.1 1230 QPKKAsqsdigkDGKKQKGKSMSKKSEKAPRKHIKIKDKKTNAEPRVSEQSSL 1282
                      23333344444444445555554444443333333333333333333333332 PP

  == domain 6  score: -1.7 bits;  conditional E-value: 0.097
         DUF4683   68 alkklaevtyklqqfkkkqsrlklgkkkeklvekrekeeeeedkastkekeksylqknalsksisetdkvlskd.vkvaeeaskskalleean 159 
                      a+k+l     klq ++++ s+                                          +se+ k l ++  +  + a++sk++ +++ 
  XP_018117079.1 1427 AQKRLLTSIGKLQDVQNSPSS-----------------------------------------LVSEKPKLLPCSfNHAGNVADTSKHCDSNTP 1478
                      333333334444444333333.........................................5555555555554445555555666655555 PP

         DUF4683  160 saslefeddseesekassligskYtLRaKRKvryeeeDseesekiknkk 208 
                      + s+e   ++ +s ++s l+  k tL++    + ++ Ds+++ +   ++
  XP_018117079.1 1479 VISSEKGHEALNSPNSSVLTTLKSTLKTTAVEQKQKGDSIDAAQFATQR 1527
                      5666666666666666666666666666555555555555554444433 PP

  == domain 7  score: -3.6 bits;  conditional E-value: 0.37
         DUF4683  277 lekYkkLAPLKdFWpkvpesratkypileltaKks................hkrKaKvksakkkriqrlkkiekkvlkrtls 342 
                      l+  + +A LK+   k++++ a  +  ++++ K s                h +K++            +++++kv+k+  +
  XP_018117079.1 1556 LDAHSGIAVLKELLHKKQQKVASSSEESTVKLKLSlsspsepksvsgksatHSKKTR----------APRSTKSKVAKNVKT 1627
                      566667788888888888888888888888888887777643333333333222222..........222222222222222 PP



Or compare XP_018117079.1 to CDD or PaperBLAST