PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001284878.1 to PF15787 (DUF4704)

NP_001284878.1 has 3446 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   9.4e-122  391.7   4.7   2.7e-121  390.1   4.7    1.9  1  NP_001284878.1  


Domain annotation for each sequence (and alignments):
>> NP_001284878.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  390.1   4.7  2.7e-121  2.7e-121       1     278 [.     680     954 ..     680     955 .. 0.99

  Alignments for each domain:
  == domain 1  score: 390.1 bits;  conditional E-value: 2.7e-121
         DUF4704   1 tphAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkv 95 
                     tphAlml++vkavvthsih +l+siGGiqvLfPLfsqld+++   +   d ++dp+lc++ll +i+el+e+s+t+qq+++q++Gflv++f+Lq++
  NP_001284878.1 680 TPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAH---EGLGDIKRDPTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRS 771
                     69****************************************...888999******************************************** PP

         DUF4704  96 spkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlkyyYwvv 190
                     s++hLt+evl ++l+l+k+l+++ s++s++Ll++lld+vlfnp+lWiy++ +VQ +Ly++Latefl+d++i++nvrrvstvl++++tlkyyYwvv
  NP_001284878.1 772 SREHLTLEVLGSFLNLTKYLVTCLSANSDLLLKQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVV 866
                     *********************************************************************************************** PP

         DUF4704 191 nprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrllvehpasmlpafd 278
                     npr++sgi +k+ldg+rp q++il++Ra++Ll++kql++ g+g++edelq++lnyl+t+hedenl+dvL+++++l++ehp+sm+pafd
  NP_001284878.1 867 NPRAKSGIIPKGLDGPRPAQKDILAIRAYILLFLKQLIMIGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFD 954
                     ***************************************************************************************8 PP



Or compare NP_001284878.1 to CDD or PaperBLAST