PaperBLAST – Find papers about a protein or its homologs

 

Align NP_055990.1 to PF15787 (DUF4704)

NP_055990.1 has 2754 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.2e-26   79.7   0.1    1.2e-26   79.7   0.1    2.6  3  NP_055990.1  


Domain annotation for each sequence (and alignments):
>> NP_055990.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.4   0.4      0.12      0.12      85     131 ..      63     108 ..      59     121 .. 0.76
   2 ?   -3.0   0.0      0.19      0.19      51     111 ..     374     432 ..     362     435 .. 0.75
   3 !   79.7   0.1   1.2e-26   1.2e-26      13     267 ..     877    1141 ..     873    1150 .. 0.85

  Alignments for each domain:
  == domain 1  score: -2.4 bits;  conditional E-value: 0.12
      DUF4704  85 flvlaflLqkvspkhLtrevleallslakvlkelnssaskvLlrdll 131
                  + vla+ L++++ ++  + +l+ ++ l++ l++++++ ++vL+  +l
  NP_055990.1  63 LHVLAEQLHQADLEQ-ALLLLKLFIILCRNLENIEAGRGQVLVPRVL 108
                  567888888888776.4568888888999888888888888876554 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.19
      DUF4704  51 seadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkvspkhLtrevleallsl 111
                  ++ +++++  ++++++ ++++s++ ++ + +  G   l ++Lq+  p   t ++l++ll++
  NP_055990.1 374 DQDTDAIAVHVVRVLTCIMSDSPSAKEVFKERIGYPHLQEVLQSHGPP--THRLLQELLNM 432
                  45677899999****************999999999999999988665..34444444444 PP

  == domain 3  score: 79.7 bits;  conditional E-value: 1.2e-26
      DUF4704   13 vvthsihsalesiGGiqvLfPLfsqldlpe.............................kkeaevsdseadpslcatllsliaelleasstnqqql 79  
                   v t ++++  +++GG+ +L+PL++++  +                                 +++++ +++ +++a ll  + + l+ +  nq+ l
  NP_055990.1  877 VETWDVKDVVNCVGGMGALLPLLERVAAQPkeaeagpaethdlvgpeltsghntqglvlPLGKSSEERMERNAVAAFLLM-LRNFLQGHMVNQESL 971 
                   78999******************99987767999**********************997677777776777777766665.56************* PP

      DUF4704   80 vqtkGflvlaflLqkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvst 175 
                   vq++G  ++++lL+kv++  ++++vl +   l++++    ++ s +Ll  l++++lfn++lW  +d++V     q++++ + e+ +    +r+  +
  NP_055990.1  972 VQCQGPAIIGALLRKVPSWAMDMNVLMSAQLLMEQVA---AEGSGPLLYLLYQHLLFNFHLWTLSDFAVRLGHIQYMSSIVREHRQK---LRKKYG 1061
                   ***************************9999999888...4568899999*****************************99887777...5556** PP

      DUF4704  176 vlrlldtlkyyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedel...qallnylltvhedenledvLelilrllv 267 
                   v+ +ld+l+  Y    p+ +               +++ ++ + lL l+++ ++   + s+d++   q++l++l+ + +d +   +L l+l+ll 
  NP_055990.1 1062 VQFILDALRTHYS---PQRERPL----------AADDLRTVQTSLLGLAREFLV--RSLSADDVqvtQTMLSFLAATGDDGQAVGALDLLLALLH 1141
                   ************9...3332222..........245677889999999999888..666677762235799999999999999999999999985 PP



Or compare NP_055990.1 to CDD or PaperBLAST