PaperBLAST – Find papers about a protein or its homologs

 

Align NP_497939.2 to PF15787 (DUF4704)

NP_497939.2 has 2507 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.8e-99  316.9   2.1    5.8e-99  316.9   2.1    2.7  3  NP_497939.2  


Domain annotation for each sequence (and alignments):
>> NP_497939.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    2.5   0.2     0.004     0.004      49     183 ..     197     240 ..     160     277 .. 0.57
   2 !  316.9   2.1   5.8e-99   5.8e-99       2     278 ..     545     819 ..     544     820 .. 0.98
   3 ?   -3.5   0.1      0.27      0.27     149     190 ..    1455    1497 ..    1453    1526 .. 0.64

  Alignments for each domain:
  == domain 1  score: 2.5 bits;  conditional E-value: 0.004
      DUF4704  49 sdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadv 146
                    s  d++l +++ sl+  ++++s++n                                                                       
  NP_497939.2 197 LLSHCDYDLQNEIWSLFLAVMKKSNRN----------------------------------------------------------------------- 223
                  444555555555555555555555554....................................................................... PP

      DUF4704 147 eVQkkLyqfLatefledesilknvrrvstvlrlldtl 183
                                      l+   rv  + ++ld+l
  NP_497939.2 224 --------------------LEACTRVGLISKVLDIL 240
                  ....................44444444444444443 PP

  == domain 2  score: 316.9 bits;  conditional E-value: 5.8e-99
      DUF4704   2 phAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkvspkh 99 
                  phA+m++gv++++thsih++l+s+GGiq+L+PLf+q+dlp+     ++d+  d ++c+tllslia ll++s+++qqql+++kGfl+++ +Lqk+sp+h
  NP_497939.2 545 PHAVMKEGVEVITTHSIHKSLQSVGGIQILLPLFAQIDLPS-----SNDNSIDGEVCQTLLSLIALLLSSSQSSQQQLFHSKGFLIISSCLQKASPSH 637
                  8****************************************.....9999************************************************ PP

      DUF4704 100 LtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlkyyYwvvnprsrsg 197
                  L+++vle+l+++ak+l ++++  + +Ll++l+d++lfnpklWi+a++eVQ +Lyq+Lat+fl+++++ + +rrv tv+++++tlk++Yw++ p++ s+
  NP_497939.2 638 LSMKVLEQLIHIAKFLLRCPA--GGPLLKHLFDYILFNPKLWIRARPEVQVHLYQYLATDFLANNNFSQMLRRVPTVIEMCHTLKHFYWLALPQTVSD 733
                  *****************7777..*************************************************************************** PP

      DUF4704 198 iesksldgerpsqeeilklRallLllikqlvl......kgsgisedelqallnylltvhedenledvLelilrllvehpasmlpafd 278
                  ++ +++ + +  + +i+++R+ +L++i+++++      +++ ++++e+++lln+l+tv+ed+nl+dvL+l++rll+ehpa+m+pa+d
  NP_497939.2 734 YTIEERPE-NFATADIVAIRSSILTFINRIIIasagpeEEERVRDQEVHTLLNLLATVREDDNLYDVLALVTRLLAEHPAIMIPAID 819
                  ****9997.9***************************999********************************************998 PP

  == domain 3  score: -3.5 bits;  conditional E-value: 0.27
      DUF4704  149 QkkLyqfLatefledesilknvr.rvstvlrlldtlkyyYwvv 190 
                   Qk+L+    +e+++d+++l+++r r + v++l+ +l    w +
  NP_497939.2 1455 QKTLLGTHGQEIMNDTKVLETLRnRNASVIELVMLLCSQEWQT 1497
                   7777777777777777777776534455666665555444444 PP



Or compare NP_497939.2 to CDD or PaperBLAST