PaperBLAST – Find papers about a protein or its homologs

 

Align NP_899099.2 to PF15787 (DUF4704)

NP_899099.2 has 2750 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.2e-32   97.5   0.1    4.2e-32   97.5   0.1    2.5  3  NP_899099.2  


Domain annotation for each sequence (and alignments):
>> NP_899099.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -4.1   0.4       0.4       0.4      77     115 ..      77     118 ..      64     139 .. 0.53
   2 ?   -2.0   0.0      0.09      0.09      51     111 ..     373     431 ..     358     441 .. 0.75
   3 !   97.5   0.1   4.2e-32   4.2e-32      13     269 ..     876    1139 ..     872    1146 .. 0.89

  Alignments for each domain:
  == domain 1  score: -4.1 bits;  conditional E-value: 0.4
      DUF4704  77 qqlvqtkGflvlaflLqkvspk...hLtrevleallslakvl 115
                  q l+  k f +l + L++v+      L  +vl+ l+ l+  l
  NP_899099.2  77 QALLLLKLFIILCRNLENVEAGwgqVLVPRVLALLTVLMAEL 118
                  444444444555555555444333244444555555544444 PP

  == domain 2  score: -2.0 bits;  conditional E-value: 0.09
      DUF4704  51 seadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkvspkhLtrevleallsl 111
                  ++ +++++  ++++++ +++ s++ ++ + +  G   l ++Lq+  p   t ++l++ll++
  NP_899099.2 373 DQDTDAIAVHVVRVLTCIMSGSPSAKEVFKERIGYQHLQEVLQSHGPP--THRLLQELLNM 431
                  456678899999999999999999999999999999999999987665..34555555554 PP

  == domain 3  score: 97.5 bits;  conditional E-value: 4.2e-32
      DUF4704   13 vvthsihsalesiGGiqvLfPLfsqldlpe.............................kkeaevsdseadpslcatllsliaelleasstnqqql 79  
                   v t ++++  +++GG+ vL+PL++++  +                                 ++++d +++ +++a ll l  + l++++ nq+ l
  NP_899099.2  876 VETWDVKDVVNCVGGMGVLLPLLERVAVQPqeaeagpcethdlvgpeltsgrntqglllPLGKSSEDRMERNAVAAFLLML-RNFLQNHTVNQESL 970 
                   78999******************99987666999***********************988888888888888888887766.5************* PP

      DUF4704   80 vqtkGflvlaflLqkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvst 175 
                   vq++G  ++++lL+kv+++ ++++vl +   l++++    +  + +Ll  l++++lfn++lW  +d++V     q++++++ e+ +    +r+  +
  NP_899099.2  971 VQCQGPAIIGALLRKVPSSAMDMNVLMSAQLLMEQAA---ADGGGPLLYLLYQHLLFNFHLWTLSDFAVRLGHIQYMSSMVREHRQK---LRKKYG 1060
                   **************************99988888887...557999**********************************9888777...5555** PP

      DUF4704  176 vlrlldtlkyyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrllveh 269 
                   v+ lld+l+  Y    p+ +               +++ ++ + lL l+++ ++   + s +++q++ln+l+ + +d ++   Lel+l+ll   
  NP_899099.2 1061 VQFLLDALRTHYS---PQRERPL----------AADDLRTVQTSLLGLVREFLV--RNFSVEDMQVVLNFLAATGDDGQVVGTLELLLTLLQGS 1139
                   ************9...3332222..........346788899*********999..9*********************************9765 PP



Or compare NP_899099.2 to CDD or PaperBLAST