PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::E7FAW3 to PF15787 (DUF4704)

SwissProt::E7FAW3 has 2801 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.5e-36  111.4   0.9    1.3e-35  109.0   0.9    2.2  1  SwissProt::E7FAW3  


Domain annotation for each sequence (and alignments):
>> SwissProt::E7FAW3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.0   0.9   1.3e-35   1.3e-35      12     272 ..     914    1179 ..     911    1185 .. 0.88

  Alignments for each domain:
  == domain 1  score: 109.0 bits;  conditional E-value: 1.3e-35
            DUF4704   12 avvthsihsalesiGGiqvLfPLfsqldlpe............................kkeaevsdseadpslcatllsliaelleass 73  
                          vv+ ++++ l s+GG+ +L+PL++q+ l++                               ++++   ++ s++a ll +i ++l++++
  SwissProt::E7FAW3  914 RVVNWDVKDVLSSVGGMGALLPLLEQVCLLDqretvgqetsdllgpeltssrgpagmllPLGKSSEGRLEKNSVAAFLL-MIKNMLRNHP 1002
                         588999*********************9999999***********************9766666666666666666555.789******* PP

            DUF4704   74 tnqqqlvqtkGflvlaflLqkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefled 163 
                         +nq+ l+q++G  +++++L kv+++ ++++vl a+  l+k+++   ++ +++Ll++l++++lf++++W++++++V     q+L t ++e 
  SwissProt::E7FAW3 1003 ANQESLLQCHGPAIIGAMLGKVPSSMMDMSVLMACQFLLKQVS---NEGNNALLSQLYQYLLFDFRIWSRSHFAVCLGHVQYLTTVINEG 1089
                         ****************************************999...66899********************************9988554 PP

            DUF4704  164 esilknvrrvstvlrlldtlkyyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhede 253 
                          ++  + rr  +v+ +ld ++  Y v++  s    e               ++   l++l+k l+    + +++el+++l+y + v++++
  SwissProt::E7FAW3 1090 -KL--KTRRKYGVQYILDSIRTHYSVEKDGSPLSDE-------------RQTVQISLFSLLKDLLK---SPTAEELHSVLAYAAIVQDEQ 1160
                         .45..57888***************77655543332.............2345579*********9...999****************** PP

            DUF4704  254 nledvLelilrllvehpas 272 
                         +++ vL  + ++l + p +
  SwissProt::E7FAW3 1161 QVISVLDVLHTVLKSSPPP 1179
                         ********99999888765 PP



Or compare SwissProt::E7FAW3 to CDD or PaperBLAST