PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q6ZS30 to PF15787 (DUF4704)

SwissProt::Q6ZS30 has 2694 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    8.4e-38  116.2   0.6    8.4e-38  116.2   0.6    3.0  3  SwissProt::Q6ZS30  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q6ZS30  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.8   0.2      0.16      0.16      55     125 ..     323     395 ..     301     403 .. 0.72
   2 !  116.2   0.6   8.4e-38   8.4e-38      12     271 ..     858    1123 ..     853    1132 .. 0.93
   3 ?   -2.3   0.7      0.11      0.11     107     170 ..    1201    1261 ..    1142    1271 .. 0.65

  Alignments for each domain:
  == domain 1  score: -2.8 bits;  conditional E-value: 0.16
            DUF4704  55 pslcatllsliaellea..sstnqqqlvqtkGflvlaflLqkvspk..hLtrevleallslakvlkelnssaskv 125
                         +l +++l+ i+ +l+    + +q  +++++ f+ l +lLq+ +    +L+   ++++  l+ v+++ ++  +k 
  SwissProt::Q6ZS30 323 IALQIKMLNTITAMLDCtdRPVLQAIFLNSNCFEHLIRLLQNCKVFqgQLDCLAISTIQALTAVMNKSPA--AKE 395
                        5677788888888887511567888899999999999999987754458999999999999998884443..444 PP

  == domain 2  score: 116.2 bits;  conditional E-value: 8.4e-38
            DUF4704   12 avvthsihsalesiGGiqvLfPLfsqldlpe..........................kkeaevsdseadpslcatllsliaelleasstn 75  
                          vv+ +i++++++iGG++vLfPL++q+ + +                            + + s+s  + +l+at + ++ + ++ ++ n
  SwissProt::Q6ZS30  858 KVVNWDIKDIINCIGGLNVLFPLLEQISHFSegqipeeknestvpesvtpvegdwlvWTSTKASESRLERNLVATFILIVKHFIQRHPIN 947 
                         588999*************************************************9977888888899********************** PP

            DUF4704   76 qqqlvqtkGflvlaflLqkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledes 165 
                         q +l++++G+  l++lLqkv+++ ++ +vl a+  l+++++ l+  ++ +Ll+++++++lf++++W + d+       q+L+t + ++ +
  SwissProt::Q6ZS30  948 QGNLIHSHGVATLGALLQKVPSTLMDVNVLMAVQLLIEQVS-LE--KNMQLLQQMYQYLLFDFRIWNRGDFPFRIGHIQYLSTIIKDSRR 1034
                         *********************************99999999.44..589************************************99999 PP

            DUF4704  166 ilknvrrvstvlrlldtlkyyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenl 255 
                         ++++     +v+ lldtl+ yY        +g +  +      s ++i ++R+ l  lik  ++  +g s++e+q+++ y++ ++e+e+l
  SwissProt::Q6ZS30 1035 VFRKK---YGVQFLLDTLRIYYG-------NGCKYNE-----LSLDDIRTIRTSLYGLIKYFLC--KGGSHEEIQSIMGYIAATNEEEQL 1107
                         98777...**************9.......3443333.....45689*****************..88999******************* PP

            DUF4704  256 edvLelilrllvehpa 271 
                           +L  + +ll   p+
  SwissProt::Q6ZS30 1108 FGILDVLFSLLRTSPT 1123
                         **********998776 PP

  == domain 3  score: -2.3 bits;  conditional E-value: 0.11
            DUF4704  107 allslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknv 170 
                          +++l++++    +++  + ++dll+ v++ ++  i+ +v++ +k +q+L  +  + ++i ++v
  SwissProt::Q6ZS30 1201 LIKNLTHQII---NTDPVINFKDLLSVVYISHRAHINVRVAICRKVLQILQFQPDAAHQISQQV 1261
                         3444554444...223334478888888888888888888888888888877777777766655 PP



Or compare SwissProt::Q6ZS30 to CDD or PaperBLAST