PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8NFP9 to PF15787 (DUF4704)

SwissProt::Q8NFP9 has 2946 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   4.1e-114  366.6   2.4   4.1e-114  366.6   2.4    2.5  2  SwissProt::Q8NFP9  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8NFP9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  366.6   2.4  4.1e-114  4.1e-114       1     279 []     472     743 ..     472     743 .. 0.99
   2 ?   -0.7   0.9     0.037     0.037     116     175 ..     795     866 ..     744     926 .. 0.62

  Alignments for each domain:
  == domain 1  score: 366.6 bits;  conditional E-value: 4.1e-114
            DUF4704   1 tphAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflL 92 
                        +phAlml++vka+vthsihsa++siGGiqvLfPLf+qld  +      +ds+ ++++catll++++ell++s ++q+q++  kGflv+++lL
  SwissProt::Q8NFP9 472 SPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQ-----LNDSQVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLL 558
                        58****************************************.....9999***************************************** PP

            DUF4704  93 qkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlk 184
                        +k+s+ h+tr vle++ls+ak+l     s++ +Ll++l+d++lfnp++Wi+++ +VQ +Ly++L+ ef+ +++i++++rrv tvl+l++tlk
  SwissProt::Q8NFP9 559 EKSSRVHITRAVLEQFLSFAKYLD--GLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLK 648
                        ************************..5557************************************************************** PP

            DUF4704 185 yyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrllvehpasmlpa 276
                        yyYwv np+++sgi++k+ldg+rpsq+ei++lRa++Ll++kql+lk+ g++edelq++lnyllt+heden++dvL+l+++l++ehpasm+pa
  SwissProt::Q8NFP9 649 YYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPA 740
                        ******************************************************************************************** PP

            DUF4704 277 fde 279
                        fd+
  SwissProt::Q8NFP9 741 FDQ 743
                        *95 PP

  == domain 2  score: -0.7 bits;  conditional E-value: 0.037
            DUF4704 116 k............elnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvst 175
                                     ++ ++ +++L ++++ +v+ +p+    ++v++Q+ +    +  +l++++   ++ +v +
  SwissProt::Q8NFP9 795 GerlmlhtntvtvTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRR 866
                        033344455555677888999999999999999999999999999998887777777777776666644444 PP



Or compare SwissProt::Q8NFP9 to CDD or PaperBLAST