PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9ESE1 to PF15787 (DUF4704)

SwissProt::Q9ESE1 has 2856 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   2.1e-111  357.7   7.0   2.1e-111  357.7   7.0    2.7  2  SwissProt::Q9ESE1  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9ESE1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  357.7   7.0  2.1e-111  2.1e-111       1     279 []     446     717 ..     446     717 .. 0.99
   2 !    1.6   0.1    0.0072    0.0072      30      86 ..     786     843 ..     768     848 .. 0.79

  Alignments for each domain:
  == domain 1  score: 357.7 bits;  conditional E-value: 2.1e-111
            DUF4704   1 tphAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflL 92 
                        +phAlml++vkav+thsi+sa++siGG+qvLfPLf+qld+++     + ++e d ++c+tll++i+ell++s ++q+q++++kGflv+++ L
  SwissProt::Q9ESE1 446 SPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYKQ-----YLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSL 532
                        58****************************************.....9999***************************************** PP

            DUF4704  93 qkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlk 184
                        +k+s++h++r vle +l ++k+l++l++  + +Ll++l+d++l+np++Wi+++ +VQ  Ly++L+tef+ + +i++++rrv tvl +++tlk
  SwissProt::Q9ESE1 533 EKSSKSHVSRAVLELCLAFSKYLSNLQN--GMPLLKQLCDHILLNPAVWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLK 622
                        ************************7776..9************************************************************* PP

            DUF4704 185 yyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrllvehpasmlpa 276
                        yyYw vnp++rsgi++k+ldg+rp+q+eil+lRa+lL++ikqlv+k+sg++edelqa+lnyllt+hed+nl+dvL+l+++l++ehp+sm+pa
  SwissProt::Q9ESE1 623 YYYWAVNPQDRSGITPKGLDGPRPNQKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAEHPNSMIPA 714
                        ******************************************************************************************** PP

            DUF4704 277 fde 279
                        fd+
  SwissProt::Q9ESE1 715 FDQ 717
                        *95 PP

  == domain 2  score: 1.6 bits;  conditional E-value: 0.0072
            DUF4704  30 vLfP.Lfsqldlpekkeaevsdseadpslca.tllsliaelleasstnqqqlvqtkGfl 86 
                        vLf  L++q+ ++   +++ +d +++ ++ + ++l++ia ll++s++  + +   + fl
  SwissProt::Q9ESE1 786 VLFEiLIEQICTQV-IHKQHPDPDSTVKIQNpQILKVIATLLRNSPQCPESMEVRRAFL 843
                        66642779999999.555555556666665438*****************998888875 PP



Or compare SwissProt::Q9ESE1 to CDD or PaperBLAST