PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9W4E2 to PF15787 (DUF4704)

SwissProt::Q9W4E2 has 3466 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   4.3e-117  376.4   5.3   1.5e-116  374.5   5.3    2.1  1  SwissProt::Q9W4E2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9W4E2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  374.5   5.3  1.5e-116  1.5e-116       1     278 [.     634     918 ..     634     919 .. 0.96

  Alignments for each domain:
  == domain 1  score: 374.5 bits;  conditional E-value: 1.5e-116
            DUF4704   1 tphAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflL 92 
                        tphAlml++vkavvthsih +l+siGGiqvLfPLfsqld+++   +   d ++dp+lc++ll +i+el+e+s+t+qq+++q++Gflv++f+L
  SwissProt::Q9W4E2 634 TPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAH---EGLGDIKRDPTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFML 722
                        69****************************************...888999***************************************** PP

            DUF4704  93 qkvspkhLtrevleallslakvlkelnssaskvLlrdll..........dkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvs 174
                        q++s++hLt+evl ++l+l+k+l+++ s++s++Ll++l+          d+vlfnp+lWiy++ +VQ +Ly++Latefl+d++i++nvrrvs
  SwissProt::Q9W4E2 723 QRSSREHLTLEVLGSFLNLTKYLVTCLSANSDLLLKQLFcfsfltwqllDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVS 814
                        ************************9999999999997644444444444******************************************* PP

            DUF4704 175 tvlrlldtlkyyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrll 266
                        tvl++++tlkyyYwvvnpr++sgi +k+ldg+rp q++il++Ra++Ll++kql++ g+g++edelq++lnyl+t+hedenl+dvL+++++l+
  SwissProt::Q9W4E2 815 TVLQTVHTLKYYYWVVNPRAKSGIIPKGLDGPRPAQKDILAIRAYILLFLKQLIMIGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLM 906
                        ******************************************************************************************** PP

            DUF4704 267 vehpasmlpafd 278
                        +ehp+sm+pafd
  SwissProt::Q9W4E2 907 SEHPSSMVPAFD 918
                        ***********8 PP



Or compare SwissProt::Q9W4E2 to CDD or PaperBLAST