PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006501590.1 to PF15787 (DUF4704)

XP_006501590.1 has 2928 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   5.7e-114  366.1   2.2   5.7e-114  366.1   2.2    2.5  2  XP_006501590.1  


Domain annotation for each sequence (and alignments):
>> XP_006501590.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  366.1   2.2  5.7e-114  5.7e-114       1     279 []     462     733 ..     462     733 .. 0.99
   2 ?   -0.7   0.8     0.037     0.037     116     174 ..     785     855 ..     734     915 .. 0.64

  Alignments for each domain:
  == domain 1  score: 366.1 bits;  conditional E-value: 5.7e-114
         DUF4704   1 tphAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkv 95 
                     +phAlml++vka+vthsihsa++siGGiqvLfPLf+qld  +      +ds+ ++++catll++++ell++s ++q+q++  kGflv+++lL+k+
  XP_006501590.1 462 SPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQ-----LNDSQVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKS 551
                     58****************************************.....9999******************************************** PP

         DUF4704  96 spkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlkyyYwvv 190
                     s+ h+tr vle++ls+ak+l     s++ +Ll++l+d++lfnp++Wi+++ +VQ +Ly++L+ ef+ +++i++++rrv tvl+l++tlkyyYwv 
  XP_006501590.1 552 SRVHITRAVLEQFLSFAKYLD--GLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVI 644
                     *********************..5557******************************************************************** PP

         DUF4704 191 nprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrllvehpasmlpafde 279
                     np+++sgi++k+ldg+rpsq+ei++lRa++Ll++kql+lk+ g++edelq++lnyllt+heden++dvL+l+++l++ehpasm+pafd+
  XP_006501590.1 645 NPADSSGIAPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQ 733
                     ***************************************************************************************95 PP

  == domain 2  score: -0.7 bits;  conditional E-value: 0.037
         DUF4704 116 k............elnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvs 174
                                  ++ ++ +++L ++++ +v+ +p+    ++v++Q+ +    +  +l++++   ++ +v 
  XP_006501590.1 785 GerlmlhtntvtvTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVR 855
                     03333445555567788899999999999999999999999999999888777777777776656554444 PP



Or compare XP_006501590.1 to CDD or PaperBLAST