PaperBLAST – Find papers about a protein or its homologs

 

Align XP_011509960.1 to PF15787 (DUF4704)

XP_011509960.1 has 2736 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.6e-38  116.2   0.6    8.6e-38  116.2   0.6    3.3  3  XP_011509960.1  


Domain annotation for each sequence (and alignments):
>> XP_011509960.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   0.8     0.036     0.036     100     171 ..     325     402 ..     257     419 .. 0.76
   2 !  116.2   0.6   8.6e-38   8.6e-38      12     271 ..     887    1152 ..     882    1161 .. 0.93
   3 ?   -2.3   0.7      0.11      0.11     107     170 ..    1230    1290 ..    1171    1300 .. 0.65

  Alignments for each domain:
  == domain 1  score: -0.6 bits;  conditional E-value: 0.036
         DUF4704 100 LtrevleallslakvlkelnssaskvLlrdlldk...vlfnpklWiyadveV....QkkLyqfLatefledesilknvr 171
                     L+ ++l++++ ++++    +  ++  L ++ +++   +l n kl ++a+ +V     k+L   L+te++ed+ ++ ++ 
  XP_011509960.1 325 LQIKMLNTITAMLDCTD-RPVLQAIFLNSNCFEHlirLLQNCKLFLNANNKVadknEKDLANKLLTEMNEDQVFQGQLD 402
                     56688888888888888.444455555555555422279999******9999333335799999999999998887763 PP

  == domain 2  score: 116.2 bits;  conditional E-value: 8.6e-38
         DUF4704   12 avvthsihsalesiGGiqvLfPLfsqldlpe..........................kkeaevsdseadpslcatllsliaelleasstnqqq 78  
                       vv+ +i++++++iGG++vLfPL++q+ + +                            + + s+s  + +l+at + ++ + ++ ++ nq +
  XP_011509960.1  887 KVVNWDIKDIINCIGGLNVLFPLLEQISHFSegqipeeknestvpesvtpvegdwlvWTSTKASESRLERNLVATFILIVKHFIQRHPINQGN 979 
                      588999*************************************************9977888888899************************* PP

         DUF4704   79 lvqtkGflvlaflLqkvspkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvr 171 
                      l++++G+  l++lLqkv+++ ++ +vl a+  l+++++ l+  ++ +Ll+++++++lf++++W + d+       q+L+t + ++ +++++  
  XP_011509960.1  980 LIHSHGVATLGALLQKVPSTLMDVNVLMAVQLLIEQVS-LE--KNMQLLQQMYQYLLFDFRIWNRGDFPFRIGHIQYLSTIIKDSRRVFRKK- 1068
                      ******************************99999999.44..589************************************9999998777. PP

         DUF4704  172 rvstvlrlldtlkyyYwvvnprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilr 264 
                         +v+ lldtl+ yY        +g +  +      s ++i ++R+ l  lik  ++  +g s++e+q+++ y++ ++e+e+l  +L  + +
  XP_011509960.1 1069 --YGVQFLLDTLRIYYG-------NGCKYNE-----LSLDDIRTIRTSLYGLIKYFLC--KGGSHEEIQSIMGYIAATNEEEQLFGILDVLFS 1145
                      ..**************9.......3443333.....45689*****************..88999**************************** PP

         DUF4704  265 llvehpa 271 
                      ll   p+
  XP_011509960.1 1146 LLRTSPT 1152
                      *998776 PP

  == domain 3  score: -2.3 bits;  conditional E-value: 0.11
         DUF4704  107 allslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknv 170 
                       +++l++++    +++  + ++dll+ v++ ++  i+ +v++ +k +q+L  +  + ++i ++v
  XP_011509960.1 1230 LIKNLTHQII---NTDPVINFKDLLSVVYISHRAHINVRVAICRKVLQILQFQPDAAHQISQQV 1290
                      3444554444...223334478888888888888888888888888888877777777766655 PP



Or compare XP_011509960.1 to CDD or PaperBLAST