PaperBLAST – Find papers about a protein or its homologs

 

Align XP_016864361.1 to PF15787 (DUF4704)

XP_016864361.1 has 2857 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   7.3e-111  355.9   7.0   7.3e-111  355.9   7.0    2.7  3  XP_016864361.1  


Domain annotation for each sequence (and alignments):
>> XP_016864361.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  355.9   7.0  7.3e-111  7.3e-111       1     279 []     446     717 ..     446     717 .. 0.99
   2 ?    0.5   0.1     0.016     0.016      81     154 ..     717     789 ..     716     804 .. 0.81
   3 ?    0.8   0.1     0.013     0.013      29      86 ..     785     843 ..     767     848 .. 0.77

  Alignments for each domain:
  == domain 1  score: 355.9 bits;  conditional E-value: 7.3e-111
         DUF4704   1 tphAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkv 95 
                     +phAlml++vkav+thsi+sa++siGG+qvLfPLf+qld+ +     + ++e d ++c+tll++i+ell++s ++q+q++++kGflv+++ L+k+
  XP_016864361.1 446 SPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYRQ-----YLSDEIDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKS 535
                     58****************************************.....9999******************************************** PP

         DUF4704  96 spkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlkyyYwvv 190
                     s++h++r vle +l ++k+l++l++  + +Ll++l+d+vl+np++Wi+++ +VQ  Ly++L+tef+ + +i++++rrv tvl +++tlkyyYw v
  XP_016864361.1 536 SKSHVSRAVLELCLAFSKYLSNLQN--GMPLLKQLCDHVLLNPAIWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAV 628
                     *********************7776..9******************************************************************* PP

         DUF4704 191 nprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrllvehpasmlpafde 279
                     np++rsgi++k+ldg+rp+q+e+l+lRa+lL++ikqlv+k+sg++edelqa+lnyllt+hed+nl+dvL+l+++l++ehp+sm+pafd+
  XP_016864361.1 629 NPQDRSGITPKGLDGPRPNQKEMLSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQ 717
                     ***************************************************************************************95 PP

  == domain 2  score: 0.5 bits;  conditional E-value: 0.016
         DUF4704  81 qtkGflvlaflLqkvspkhLtrevleallslakvlk...elnssaskvLlrdlldkvlfnpklWiyadveVQkkLyq 154
                     q +G+ v+ +lL  ++++ +  + l+a+  ++k l    +++   ++ L++ l ++++++ +l  +++++V   L+ 
  XP_016864361.1 717 QRNGLRVIYKLLA-SKSEGIRVQALKAMGYFLKHLApkrKAEVMLGHGLFSLLAERLMLQTNLITMTTYNV---LFE 789
                     678999*999986.56789****************987777778889999999999999999999999998...344 PP

  == domain 3  score: 0.8 bits;  conditional E-value: 0.013
         DUF4704  29 qvLfP.Lfsqldlpekkeaevsdseadpslca.tllsliaelleasstnqqqlvqtkGfl 86 
                     +vLf  L++q+ ++   +++ +d +++ ++ + ++l++ia ll++s++  + +   + fl
  XP_016864361.1 785 NVLFEiLIEQIGTQV-IHKQHPDPDSSVKIQNpQILKVIATLLRNSPQCPESMEVRRAFL 843
                     567742679999998.555555556666665438*****************998888875 PP



Or compare XP_016864361.1 to CDD or PaperBLAST