PaperBLAST – Find papers about a protein or its homologs

 

Align XP_017213453.1 to PF15787 (DUF4704)

XP_017213453.1 has 2223 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   4.4e-113  363.2   1.3   4.4e-113  363.2   1.3    3.0  3  XP_017213453.1  


Domain annotation for each sequence (and alignments):
>> XP_017213453.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.3     0.084     0.084     138     183 ..     118     163 ..     105     189 .. 0.80
   2 !  363.2   1.3  4.4e-113  4.4e-113       1     279 []     468     739 ..     468     739 .. 0.99
   3 !    2.5   1.2    0.0038    0.0038      76     221 ..     753     916 ..     740     925 .. 0.65

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.084
         DUF4704 138 pklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtl 183
                      +l  ++dv+ Q ++ ++    + ++ ++l++  +v  ++++l+ +
  XP_017213453.1 118 VELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIQQVLQKM 163
                     5556678888888888888888888888888888888888888766 PP

  == domain 2  score: 363.2 bits;  conditional E-value: 4.4e-113
         DUF4704   1 tphAlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpekkeaevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkv 95 
                     +phAlml++vka+vthsihsa++siGGiqvLfPLfsqld+ +     ++ds  ++++catll++++ell++s ++q+q++  kGflv+++lL+k+
  XP_017213453.1 468 SPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFSQLDYRQ-----PNDSPVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKS 557
                     58****************************************.....99999******************************************* PP

         DUF4704  96 spkhLtrevleallslakvlkelnssaskvLlrdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlkyyYwvv 190
                     s+ h+tr vle++ls+ak+l     +++ +Ll++l+d+vlfn ++Wi+++ +VQ +Ly++L+ ef+ +++i++++rrv tvl+l++tlkyyYw  
  XP_017213453.1 558 SRVHITRAVLEQFLSFAKYLD--GLTHGAPLLKQLCDHVLFNAAIWIHTPAKVQLSLYTYLSAEFIGTATIYSTIRRVGTVLQLMHTLKYYYWAS 650
                     *********************..5556******************************************************************** PP

         DUF4704 191 nprsrsgiesksldgerpsqeeilklRallLllikqlvlkgsgisedelqallnylltvhedenledvLelilrllvehpasmlpafde 279
                     np ++sgi++k+ldg+rpsq+ei++lRa++Ll++kql+lk+ g++edelq++lnyllt+heden++dvL+l+++l++ehpasm+pafd+
  XP_017213453.1 651 NPLESSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQ 739
                     ***************************************************************************************95 PP

  == domain 3  score: 2.5 bits;  conditional E-value: 0.0038
         DUF4704  76 qqqlvqtkGflvlaflLqkvspk.hLtr.......evleallslakvlk.........elnssaskvLlrdlldkvlfnpklWiyadveVQkkLy 153
                     +++ ++ + + vl++ L+++  k +++        ++l +                  ++ ++ +++L ++++ +v+ +p+    ++v++Q+ + 
  XP_017213453.1 753 KSESIRVQALKVLGYFLKHLGHKrKVEImhthslfTLLGER-------LmmhtstvtiTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMI 840
                     44556666777777777776555433332233333333222.......1344455566888899****************************999 PP

         DUF4704 154 qfLatefledesilknvrrvstvlrlldtlkyyYwvvnprsrsgiesksldg..........erpsqeeilklRallL 221
                        +  +l+++s   ++ +v +++ l d++k +    +++ r + + +  ++          ++p++++i++++ +++
  XP_017213453.1 841 LKVVATLLKSSSPSAELMEVRRLF-LSDMIKLFSN-SRENRRCLLQCSVWQDwmfslgyinpKNPEEQKITEMVYNIF 916
                     988888888888877775555543.3467776655.555555444444444466677777766677777777666665 PP



Or compare XP_017213453.1 to CDD or PaperBLAST