PaperBLAST – Find papers about a protein or its homologs

 

Align XP_645593.1 to PF15787 (DUF4704)

XP_645593.1 has 2806 amino acids

Query:       DUF4704  [M=279]
Accession:   PF15787.5
Description: Domain of unknown function (DUF4704)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-23   69.1  12.1    2.2e-19   55.8   5.1    3.6  4  XP_645593.1  


Domain annotation for each sequence (and alignments):
>> XP_645593.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   15.6   0.0   3.9e-07   3.9e-07       4      42 ..     366     404 ..     363     445 .. 0.74
   2 !   55.8   5.1   2.2e-19   2.2e-19      46     253 ..     489     734 ..     471     753 .. 0.82
   3 ?   -2.6   0.0      0.14      0.14     238     269 ..     800     865 ..     796     869 .. 0.71
   4 ?   -3.2   0.1      0.22      0.22      55      96 ..    1350    1390 ..    1336    1398 .. 0.61

  Alignments for each domain:
  == domain 1  score: 15.6 bits;  conditional E-value: 3.9e-07
      DUF4704   4 AlmlggvkavvthsihsalesiGGiqvLfPLfsqldlpe 42 
                  A  +g+ k  +t si+++++ iGG q++fPL++ ++ + 
  XP_645593.1 366 AFSIGDLKIFSTFSIKDSIYLIGGPQIIFPLLQAIEDQF 404
                  5557889999**********************6655443 PP

  == domain 2  score: 55.8 bits;  conditional E-value: 2.2e-19
      DUF4704  46 aevsdseadpslcatllsliaelleasstnqqqlvqtkGflvlaflLqkvspkhLtr................evleallslakvlkelnssaskvLl 127
                   ++ ++  ++   + +l++i++ll + + nq++l+ ++G+++l++l  ++ +++ ++                 + +al +l+++       ++++L 
  XP_645593.1 489 INQLSKLINYPRISSILRFITHLLINDKYNQKELIGSNGLSLLGYLISNIFSNSDSNpshpynfktlereefdLIFDALDQLTDFSL---VDKNPLLK 583
                  555667778888899********************************9987775555666777777777555544444444444444...24578888 PP

      DUF4704 128 rdlldkvlfnpklWiyadveVQkkLyqfLatefledesilknvrrvstvlrlldtlkyyYwvvnprsrsgiesksldg.................... 205
                   +++++++fn+++W++ + e Q +L+  ++ ++ ++ + +++    + v  lld +ky+Y +++ +  s+ +  + ++                    
  XP_645593.1 584 LNIYKEIIFNFNIWVHIKKEYQIQLFNLIIFKVSQNPQYFREN---IKVRYLLDCIKYFYHINENTIISTNNNNNNNNigessgannnnnnnnnntnn 678
                  8*****************************9999888886666...9**************98888877777777777999***************** PP

      DUF4704 206 .......erpsqeeilklRallLllikqlvl.kgsgisedelqallnylltvhede 253
                            s++++ ++ ++++ +ik ++    ++ +  e+q +++++++ + + 
  XP_645593.1 679 vgncrlnCHLSNQDLKEIISYIFDIIKIIIKpILNEKEVPEIQEIIKFIQDSECNS 734
                  ******98899999************999995557788899999999997765444 PP

  == domain 3  score: -2.6 bits;  conditional E-value: 0.14
      DUF4704 238 elqallnylltvhe..................................denledvLelilrllveh 269
                  ++++ll +l+  +e                                  ++ l dvL++i++ l+e+
  XP_645593.1 800 DIKSLLGLLKHNNEqvqvlvikiigkymggseglsmassgnvrrslklKNTLTDVLYFITDQLMEF 865
                  677777777777776666666666666666666777777777777776888999999999888875 PP

  == domain 4  score: -3.2 bits;  conditional E-value: 0.22
      DUF4704   55 pslcatllsliaelleasstnqqqlvqtkGflvlaflLqkvs 96  
                   ++++  + sli  +++ ++tn+++ +  +  +++  lL+++ 
  XP_645593.1 1350 KHVMWIVCSLI-TIIRRHKTNNEDKIIINTQSIIISLLKQLL 1390
                   44444445555.666777777776666666666666666654 PP



Or compare XP_645593.1 to CDD or PaperBLAST