PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001035701.1 to PF16297 (DUF4939)

NP_001035701.1 has 376 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      2e-18   52.6   0.0    4.7e-18   51.4   0.0    1.6  1  NP_001035701.1  


Domain annotation for each sequence (and alignments):
>> NP_001035701.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.4   0.0   4.7e-18   4.7e-18      28     104 ..     137     213 ..     128     220 .. 0.96

  Alignments for each domain:
  == domain 1  score: 51.4 bits;  conditional E-value: 4.7e-18
         DUF4939  28 fpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvf 104
                      pe+fdG+ d l  f+ q   +m    + fs d ++v f+ + l G+a +w+   +++ ++l+ +y+af+ e+k+vf
  NP_001035701.1 137 LPEKFDGNPDMLGPFMYQCQLFMEKSTRDFSVDRIRVCFVTSMLIGRAARWATAKLQRCTYLMHNYTAFMMELKHVF 213
                     69**************************************************************************9 PP



Or compare NP_001035701.1 to CDD or PaperBLAST