PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001127830.4 to PF16297 (DUF4939)

NP_001127830.4 has 1357 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-16   46.9   0.0    2.4e-16   45.9   0.0    1.4  1  NP_001127830.4  


Domain annotation for each sequence (and alignments):
>> NP_001127830.4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.9   0.0   2.4e-16   2.4e-16      18     106 ..     183     271 ..     168     275 .. 0.90

  Alignments for each domain:
  == domain 1  score: 45.9 bits;  conditional E-value: 2.4e-16
         DUF4939  18 qkrrwrnpipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvfGw 106
                     +k + +  +p p tf+Gd     efiv     +     ++ sd l+v +++++l+G alew+   ++k+spl++d+ afl+ m  +f +
  NP_001127830.4 183 AKGLHEGRMPIPATFSGDRREYHEFIVLCQLILQSYPGMYYSDRLRVGYVMCHLSGMALEWAKDLMEKNSPLVSDFPAFLEAMSDMFEY 271
                     45667778999****************99988888899**********************************************99976 PP



Or compare NP_001127830.4 to CDD or PaperBLAST