PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001128360.1 to PF16297 (DUF4939)

NP_001128360.1 has 1358 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.2e-18   51.3   0.0    1.2e-17   50.1   0.0    1.5  1  NP_001128360.1  


Domain annotation for each sequence (and alignments):
>> NP_001128360.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   50.1   0.0   1.2e-17   1.2e-17      25     106 ..     199     280 ..     185     284 .. 0.94

  Alignments for each domain:
  == domain 1  score: 50.1 bits;  conditional E-value: 1.2e-17
         DUF4939  25 pipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvfGw 106
                      +p p++f+Gd   + efiv     +    ++f +d l+v ++i +l+G alew+   ++++spl++d+ afl+ m +vf +
  NP_001128360.1 199 QLPAPKHFSGDRREFHEFIVLCQLTLQSYPRMFYNDRLRVGYVINHLSGLALEWAKALLQENSPLIGDFPAFLEAMSEVFEY 280
                     5899*****************999999999*************************************************986 PP



Or compare NP_001128360.1 to CDD or PaperBLAST