PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001165908.1 to PF16297 (DUF4939)

NP_001165908.1 has 784 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.1e-20   57.1   0.0    1.6e-19   56.1   0.0    1.4  1  NP_001165908.1  


Domain annotation for each sequence (and alignments):
>> NP_001165908.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   56.1   0.0   1.6e-19   1.6e-19      22     104 ..     152     234 ..     137     240 .. 0.95

  Alignments for each domain:
  == domain 1  score: 56.1 bits;  conditional E-value: 1.6e-19
         DUF4939  22 wrnpipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvf 104
                      ++p   pe+fdG+ d l  f+ q   +m    + fs d ++v f+ + +tG+a +w+   +++  +l+ +y af+ emk+vf
  NP_001165908.1 152 EECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVF 234
                     579999****************************************************************************9 PP



Or compare NP_001165908.1 to CDD or PaperBLAST