PaperBLAST – Find papers about a protein or its homologs

 

Align NP_078903.3 to PF16297 (DUF4939)

NP_078903.3 has 364 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.3e-15   41.3   0.0      1e-14   40.6   0.0    1.2  1  NP_078903.3  


Domain annotation for each sequence (and alignments):
>> NP_078903.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.6   0.0     1e-14     1e-14      25     103 ..     100     178 ..      85     183 .. 0.90

  Alignments for each domain:
  == domain 1  score: 40.6 bits;  conditional E-value: 1e-14
      DUF4939  25 pipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrv 103
                  p   p tfdG    l  f+ q + ym  + ++++++  +v  ++ rltG+a+ w+ py++ d pl +dy  f +++k+v
  NP_078903.3 100 PGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEV 178
                  445699***********************************************************************97 PP



Or compare NP_078903.3 to CDD or PaperBLAST