PaperBLAST – Find papers about a protein or its homologs

 

Align NP_908998.1 to PF16297 (DUF4939)

NP_908998.1 has 1744 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.5
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      1e-15   43.9   0.3    3.1e-15   42.3   0.1    1.8  2  NP_908998.1  


Domain annotation for each sequence (and alignments):
>> NP_908998.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   42.3   0.1   3.1e-15   3.1e-15      26     106 ..     454     534 ..     432     538 .. 0.90
   2 ?   -3.1   0.0       0.4       0.4      12      40 ..     634     662 ..     632     668 .. 0.82

  Alignments for each domain:
  == domain 1  score: 42.3 bits;  conditional E-value: 3.1e-15
      DUF4939  26 ipfpetfdGdtdrlpefivqtlsymlvdektfssdalkvtflitrltGealewvlpyikkdspllndyraflaemkrvfGw 106
                  +p    f+Gd     ef+v     m     ++ +d l+v f+i +lt  alew+   ++++sp++n+++afl+ m ++f +
  NP_908998.1 454 LPSLRPFSGDRRDYHEFVVLCQMTMQNYPSMLYNDELRVKFVIRHLTDLALEWANDLVEQNSPVINNFSAFLEAMSEKFEY 534
                  566677**************999999999************************************************9976 PP

  == domain 2  score: -3.1 bits;  conditional E-value: 0.4
      DUF4939  12 alprlrqkrrwrnpipfpetfdGdtdrlp 40 
                  a+   ++ ++wr     p+ f+ d dr  
  NP_908998.1 634 AWMDAPAPEKWRVSSWLPNEFHPDIDRDH 662
                  6777788899****9*******9999865 PP



Or compare NP_908998.1 to CDD or PaperBLAST